KEGG   Rattus norvegicus (rat): 296467Help
Entry
296467            CDS       T01003                                 

Gene name
Ythdf1
Definition
(RefSeq) YTH N(6)-methyladenosine RNA binding protein 1
  KO
K20102  YTH domain-containing family protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    296467 (Ythdf1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     296467 (Ythdf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: YTH
Motif
Other DBs
NCBI-GeneID: 296467
NCBI-ProteinID: NP_001019927
RGD: 1308932
Ensembl: ENSRNOG00000027015
UniProt: Q4V8J6
Position
3q43
AA seq 559 aa AA seqDB search
MSATSVDPQRTKGQENKVQNGSLHQKDAVHDNDFEPYLSGQSNPSNSYPSMSDPYLSSYY
PPSIGFPYSLSEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRF
NFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQTGFHSDTLNKAPGM
NSLEQGMVGLKIGDVTTSAVKTVGSVVNSVALTGVLSGNGGTNVNMPVSKPTSWAAIASK
PAKPQPKMKTKSGPIVGGTLPPPPIKHNMDIGTWDNKGPAPKASAPQQTPSPQAAPQPQQ
VAQPLPVQPPPLVQPQYQSPQQPLQPRWVAPRNRNAAFGQSGGANSDSNSVGSAQPTSAP
SVESHPVLEKLKAAHSYNPKEFDWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR
LDGAFRSMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWIF
VKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYE
KRQEEEEVVRKERQNRNKQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccaccagcgtggacccccagagaacaaaaggacaagagaataaagtacaaaat
ggttctttgcatcagaaggatgcagttcatgacaatgactttgagccctacctttctgga
cagtccaatccgagtaacagttacccctcgatgagtgatccttacctgtccagctactac
ccaccatccattggatttccttactccctcagcgaggcaccatggtccactgcaggggac
cctcccatcccgtatctcactacctatggacaacttagtaatggagaccatcacttcatg
cacgatgctgtttttgggcaacctgggggtctggggaacaacatttaccagcacaggttt
aattttttccctgaaaaccctgcattctcagcatgggggacaagtggttctcaggggcag
cagactcagagctcagcctatgggagcagttacacttacccaccaagctcccttggtggc
acagttgttgatgggcagacaggttttcacagtgacaccctcaacaaggcccctgggatg
aacagtctggagcagggcatggttggcctgaagattggagatgttaccacctctgcagtt
aaaacagtgggttcagttgtcaacagtgtggcactgactggtgtcctttctggcaatggt
gggacaaatgtaaacatgccagtttcaaaaccaacttcatgggcagccattgccagcaag
cctgcaaaaccacagcctaagatgaaaacgaagagtgggccgatagtagggggtacgctg
cctcctccacctataaagcataacatggacattggtacttgggataacaagggccctgct
ccgaaggcctcagccccccagcagacaccatccccccaggctgctccacagccacagcag
gtagctcagcctctccctgttcagcccccacctttggtccagccacagtatcagagccct
cagcagccacttcaaccccgctgggtggctcctcgaaacagaaatgcagcatttgggcag
agtggaggggccaacagtgacagtaactctgttggaagtgctcagcctacttctgcccca
agtgtagaatcccaccctgtcctggagaaactgaaagctgcccacagctataaccctaaa
gagttcgactggaatcttaagagtgggcgggtgttcatcatcaagagctattctgaggac
gacatccaccgctccatcaagtactccatctggtgtagtactgaacatggcaacaagcgc
ctggatggcgccttccgctccatgagcagcaaggggcctgtttatctgctcttcagtgtc
aatgggagtggacatttctgtggggtggcagaaatgaagtcccctgtggactacggcacc
agtgctggggtctggtctcaggacaagtggaaggggaagtttgatgtgaagtggattttt
gtcaaggatgtgcccaataatcaactgcggcacatcagactggagaataacgacaacaag
cctgtcacaaactcccgtgacacgcaggaggtgcccttagaaaaagcaaaacaagtgctg
aagattattgcctcctataagcacacaacctccatctttgacgacttttctcattatgag
aagcgccaggaggaagaggaggtagtgcgcaaggaaaggcagaatcgaaacaaacaataa

DBGET integrated database retrieval system