KEGG   Rattus norvegicus (rat): 296499Help
Entry
296499            CDS       T01003                                 

Gene name
Dlx2, Dlx5
Definition
(RefSeq) distal-less homeobox 2
  KO
K18488  homeobox protein DLX2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    296499 (Dlx2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Dll
    296499 (Dlx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain DLL_N Homeobox_KN YdaS_antitoxin
Motif
Other DBs
NCBI-GeneID: 296499
NCBI-ProteinID: NP_001178675
RGD: 1304853
Ensembl: ENSRNOG00000001519
UniProt: G3V668
Position
3q23
AA seq 332 aa AA seqDB search
MTGVFDSLVADMHSTQITASSTYHQHQQPPSGAGAGSGGSSNSSSSNSNLHKPQESPTLP
VSTATDSSYYTNQQHPAGGGGGGASPYAHMGSYQYHASGLNNVSYSAKSSYDLGYTAAYT
SYAPYGTSSSPVNNEPDKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYL
ALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPTEQHPGASASPPCASPPVSA
PASWDFGAQQRMAGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQASGSASHLQATAP
LLHPSQTPQAHHHHHHHHHAGGGAPVSAGTIF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgactggagtctttgacagtctggtggctgatatgcactcgacccagatcacagcctcc
agcacgtaccaccagcaccagcagcccccgagcggtgcgggcgcgggctctggcggcagc
agcaacagcagcagcagcaacagcaacctgcacaagccccaggagtcgccaaccctgccg
gtgtccacggctaccgacagcagctactacaccaaccagcagcacccggcgggtggcggc
ggcgggggggcctcgccctacgcgcacatgggctcctaccagtaccacgccagcggcctc
aacaacgtctcctactccgccaaaagcagctacgacctgggctacaccgccgcgtacact
tcctacgcgccctacggaaccagttcgtccccagtcaacaacgagcccgacaaggaagac
cttgagcctgaaatccgaattgtgaacgggaagccaaagaaagtccggaaaccacgcacc
atctactccagtttccagctggccgcccttcagcgacgcttccagaagacccagtatctg
gccctgcctgagcgagccgagctggcggcctccctgggccttacccaaactcaggtcaaa
atctggttccagaaccgccgatccaagttcaagaagatgtggaagagtggcgagatcccc
acagagcagcaccctggagccagcgcttccccaccatgtgcctccccgccggtttcggcg
ccagcatcctgggacttcggcgcgcaacagcggatggcgggcggcggcccaggcagcgga
ggcagcggcgcgggcagctccggctccagcccgagcagcgccgcctcggcttttctggga
aactacccgtggtaccaccaggcttcgggctccgcttcacacctgcaggccactgcgcca
cttctgcatccctcgcagactccgcaggcgcaccaccaccaccaccatcaccaccacgca
ggcgggggcgccccggtgagcgccgggacgattttctaa

DBGET integrated database retrieval system