KEGG   Rattus norvegicus (rat): 296500Help
Entry
296500            CDS       T01003                                 

Gene name
Dlx1
Definition
(RefSeq) distal-less homeobox 1
  KO
K09314  homeobox protein DLX1/4/6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    296500 (Dlx1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Dll
    296500 (Dlx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN Homez YdaS_antitoxin
Motif
Other DBs
NCBI-GeneID: 296500
NCBI-ProteinID: NP_001094001
RGD: 1309593
Ensembl: ENSRNOG00000001520
UniProt: G3V669
Position
3q23
AA seq 255 aa AA seqDB search
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSA
SSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVR
FNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKR
SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSW
YPSAHQEAMQQPQLM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaccaccatgccagaaagtctcaacagcccggtgtcgggcaaggctgtgttt
atggagtttgggccgcccaaccagcaaatgtctccttctcccatgtcccacgggcactac
tccatgcactgtttacactcggcgggccattcgcagcccgacggtgcctacagttcggcc
tcatccttctcccgaccgctgggctacccctacgtcaactcggtcagcagccacgcgtcc
agcccctacatcagttccgtgcagtcctaccccggcagcgccagcctcgcccagagccgc
ctggaggacccaggggcggactccgagaagagcaccgtggtggaaggcggagaagtgcgc
tttaacggcaaagggaaaaagatccgtaaacccaggacaatttattccagtttgcagttg
caggctttgaaccggaggttccaacaaactcagtacctagctctgcctgagagggcggag
ctggcggcctccttgggactcacacagactcaggtcaagatatggttccagaacaaacgc
tccaagttcaagaagctgatgaagcaaggcggggcagctctggagggcagcgcgctggcg
aatggcagggccttgtctgccggctccccaccggtaccacccggctggaatccgaattcc
tcctctgggaagggctccggcagcagcgctggctcctacgtccccagctacacgtcgtgg
tatccctcagcgcaccaagaagctatgcagcagcctcaactgatgtga

DBGET integrated database retrieval system