KEGG   Rattus norvegicus (rat): 29651Help
Entry
29651             CDS       T01003                                 

Gene name
Aldh1a7, Aldh1a4, Aldhpb
Definition
(RefSeq) aldehyde dehydrogenase family 1, subfamily A7
  KO
K07249  retinal dehydrogenase [EC:1.2.1.36]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    29651 (Aldh1a7)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     29651 (Aldh1a7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-GeneID: 29651
NCBI-ProteinID: NP_058968
RGD: 620252
UniProt: P13601
Position
1q51
AA seq 501 aa AA seqDB search
MSSPAQPAVPAPLANLKIQHTKIFINNEWHNSLNGKKFPVINPATEEVICHVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGCLLNKLADLMERDRVLLATMESMNAGKIFTHAYL
LDTEVSIKALKYFAGWADKIHGQTIPSDGDVFTYTRREPIGVCGQIIPWNGPLILFIWKI
GAALSCGNTVIVKPAEQTPLTALYMASLIKEAGFPPGVVNVVPGYGSTAGAAISSHMDID
KVSFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDSAVEFAHQGVFFHQG
QICVAASRLFVEESIYDEFVRRSVERAKKYVLGNPLDSGISQGPQIDKEQHAKILDLIES
GKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSIDEVIKR
ANNTPYGLAAGVFTKDLDRAITVSSALQAGTVWVNCYLTLSVQCPFGGFKMSGNGREMGE
QGVYEYTELKTVAMKISQKNS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccctgcacagcctgcagttcctgccccactggccaacttgaagattcaacac
accaagatctttataaacaatgaatggcacaactcattgaatggcaagaaatttcctgtc
attaaccctgcaactgaagaggtcatctgccatgtggaagaaggggacaaggcagatgtt
gacaaagctgtgaaggctgcaagacaggctttccagattggctccccctggcgcaccatg
gatgcttcagagagaggatgcctgctgaacaagctggctgacttaatggagagagatcgc
gtgctgctggctacaatggaatcaatgaatgctggaaaaatctttactcatgcatacctt
ttggatacagaggtcagcataaaagccttaaagtactttgcaggctgggcagacaagatt
catggccaaacaattccaagtgatggagatgttttcacttatacaagacgtgaacctatt
ggggtgtgtggccaaatcattccttggaatggtccgttgattttattcatttggaagata
ggcgctgcccttagctgtgggaacactgtgattgtgaagccagcagagcaaactcctctc
acagctctttacatggcatctttaataaaagaggcagggtttcctcctggtgtggtgaac
gttgtccctggttatggatcaactgcaggggcagccatctcttctcacatggacatagac
aaggtgtctttcacaggatcaacagaggttggcaaattaatcaaagaagctgcagggaaa
agcaatctgaagagggtcaccctggagcttgggggaaagagcccttgcattgtgtttgca
gatgctgacttggatagtgctgttgagtttgcacaccaaggagtattcttccaccagggt
cagatttgtgtcgcagcatccagactttttgttgaggagtccatttacgatgaatttgtt
aggaggagtgtggagcgggctaagaaatacgttctaggaaatcctctggactcaggaata
agtcaaggtcctcagattgacaaggagcaacatgctaaaatccttgatctcattgagagt
gggaagaaagaaggcgccaaactggagtgtggtggaggacgctgggggaacaaaggcttc
tttgtccagcctacagtcttctccaatgtgaccgatgagatgcgcattgccaaagaggag
atatttggaccagtgcaacaaatcatgaagtttaagtccatagatgaggtgatcaagaga
gccaacaatactccctatggtctagcagcaggagtcttcacaaaagacctggacagggcc
atcactgtgtcttctgctctgcaggccgggacagtgtgggtgaattgttatttgactctc
tctgtccagtgcccatttggtgggttcaagatgtctggaaatgggcgagaaatgggtgaa
cagggtgtttatgaatacactgagctcaagacagtcgcaatgaaaatatctcagaagaac
tcctaa

DBGET integrated database retrieval system