KEGG   Rattus norvegicus (rat): 296554
Entry
296554            CDS       T01003                                 

Symbol
Tubb4b
Name
(RefSeq) tubulin beta-4B chain
  KO
K07375  tubulin beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04540  Gap junction
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    296554 (Tubb4b)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    296554 (Tubb4b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    296554 (Tubb4b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    296554 (Tubb4b)
   05012 Parkinson disease
    296554 (Tubb4b)
   05014 Amyotrophic lateral sclerosis
    296554 (Tubb4b)
   05016 Huntington disease
    296554 (Tubb4b)
   05020 Prion disease
    296554 (Tubb4b)
   05022 Pathways of neurodegeneration - multiple diseases
    296554 (Tubb4b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    296554 (Tubb4b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    296554 (Tubb4b)
   04147 Exosome [BR:rno04147]
    296554 (Tubb4b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     296554 (Tubb4b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    296554 (Tubb4b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   296554 (Tubb4b)
  Exosomal proteins of colorectal cancer cells
   296554 (Tubb4b)
  Exosomal proteins of bladder cancer cells
   296554 (Tubb4b)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 296554
NCBI-ProteinID: NP_954525
RGD: 735101
Ensembl: ENSRNOG00000010170
UniProt: Q6P9T8
Position
3
AA seq 445 aa
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTACL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgagggagatcgtgcacctgcaggctgggcagtgcggcaaccagattggcgccaagttc
tgggaggtaatcagcgacgagcatggcattgatcccactggcacgtaccacggagatagc
gacctccagctggagcgcatcaacgtgtactacaacgaggccaccggtggcaagtatgtg
ccccgcgctgtgctcgtggacttggagcccggcaccatggactcggtgcgctcagggccc
ttcgggcagatcttcagacctgataacttcgtttttggtcagagtggggctgggaacaac
tgggccaaggggcactacacagaaggtgcagagctggttgactcggtgttggacgttgtg
aggaaggaagctgagagctgtgactgcctgcaaggcttccagctgacccactccctgggt
ggggggactgggtctgggatgggtaccctccttatcagcaagatccgggaggagtaccca
gacagaatcatgaacaccttcagtgtggtcccttcccccaaggtgtcggacacagtggtt
gagccctacaatgccaccctttcagtccaccagcttgttgaaaacacagatgagacctat
tgtattgataatgaagcactctatgacatctgcttcagaaccctaaagctgaccacaccc
acttatggtgacctgaaccatctagtgtccgccaccatgagtggggtaaccgcttgccta
cgattccctggccagctaaatgctgacctgcggaaactggctgtaaatatggtgcccttc
cctcgcctgcacttcttcatgcctggctttgcccccttgaccagccggggaagccagcag
taccgagccctgacagttcctgagctcacccagcagatgtttgatgctaagaacatgatg
gctgcctgtgatccccgccatgggcgctacttgacagtggctgccgtgttcaggggccgc
atgtctatgaaggaggtggacgaacagatgcttaatgtccaaaacaagaacagcagctac
tttgttgagtggatccccaacaacgtgaaaacagctgtctgtgacattccacctcggggc
ctaaaaatgtccgccaccttcattggcaacagcacggctattcaggagctgttcaaacgc
atctcagagcagttcacagccatgttccgacgcaaggccttcctacactggtacacgggc
gagggcatggatgagatggagttcactgaggctgagagcaacatgaatgacctggtgtcc
gagtaccagcagtaccaggatgctacagctgaggaggaaggagagtttgaggaggaggct
gaggaggaggtggcttag

DBGET integrated database retrieval system