KEGG   Rattus norvegicus (rat): 296580Help
Entry
296580            CDS       T01003                                 

Gene name
Camsap1, RGD1565022
Definition
(RefSeq) calmodulin regulated spectrin-associated protein 1
  KO
K17493  calmodulin-regulated spectrin-associated protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    296580 (Camsap1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    296580 (Camsap1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     296580 (Camsap1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     296580 (Camsap1)
  Intermediate filaments
   Intermediate filament-binding proteins
    296580 (Camsap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAMSAP_CKK CAMSAP_CH CAMSAP_CC1
Motif
Other DBs
NCBI-GeneID: 296580
NCBI-ProteinID: NP_001162021
RGD: 1565022
Ensembl: ENSRNOG00000017883
UniProt: D3Z8E6
Position
3p13
AA seq 1604 aa AA seqDB search
MVDAGGRSAAEGWRRMEAPPEGADLVPLDRYDAARAKIAANLQWICAKAYGLDNIPEDLR
DPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQAATLQGHQSVIQALSRKGIYV
MESDDTPVTDADLSQAPIKMSGHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKEL
PYDLEDAMVFWINKVNLKMREITEKEVKLKQQPLESPAHQKPGLEHAVMHCMLEPVDFAR
VVRYRREHLSARQSPYFPLLEDLMRDGSDGAALLAVVHYYCPEQMKLDDICLKEVPSMAD
SLYNIRLLREFSNEHLNKCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPR
DIQELKDAKTVLQQKSSRPPVPISNATKRSFLGSPAAMSPADLPPSTQPLTEGSHRYHLH
SEEPECLGKGASTFSPSHPLLPLRQKQQKVSQAEEIPDQRHRSNSLTRADGQPRGAAIAW
PDKKNRPVSQPTSFALHHAASCDVDPSSGDSISLARSISKDSLASNIIHLTPQNQPHPSA
GKTNGKSLLSNVNIEDDEEEELVAIIRTDVSPHSPEIPRTSPQAPGLVASIRSPQRQADT
LESKPDSFYLEPLMPAVLRPAKEKQIITKEDERGEGRPRTIMAKRPSEGSQPLVRKKVTG
SHGSRDLNRTFTPIPCSEFAASIDPTEVGPQSTEATGEGQPLALGRFDPVPQGQVADGFF
LHVGRAEEDEGRWYVGSQSPSSHDSEPWTILRQDSDSDVVDVEDAEQDFIGEDHPVVIPR
YAGEEESAKLQEDMKVKEHEDKDDASGRSSPCLSTTSQLSSMSMASGSVKMTSFAERKLQ
RLNSCETKSSTSSSQKTTPDASESCPAPLTTWRQKREQSPSRHSKDPASLLASELVQLHM
QLEEKRRAIEAQKKKMEALSARQRLKLGKAAFLHVVKKGKADGAPQPLRPEHFTKEFTQH
NGEDLDDGTCKTEGFLVKEEQRDLSDSQDVAFVQLHKPRDPATLHDGEKHRVISAALLED
SVGEVDVNECDLSIEKLNETISTLQQAILKISQQQEQLLMKSPTVPTSGTKNNCQDQKVK
APVHFVEPLSPTGVPGHRKPPRLGQGRNSRSGRPAELKVPKDRQQGCSRSKTPTPSVETL
PHSRSLPPSTHPRSPLDPGGELPEKCLFDSYRLHDESNHRTFGLSSCKDANIVSEQMNFK
EGLDTSVQEAELSSSAITGKEHTPMEEPLRSKASLIEVDLSDLKAPDEDGEVVGHESSLE
LGGESDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARARKQQLEAEVELKRDE
ARRKAEEDRLRKEEEKARRELIKQEYLRRKQQQALEEQGLGKPKSKPKKPRPKSVHREES
CSDSGTKCSSTPDNLSQTHSGSSLSLASAATTEPESVHSGGTPSHRVESLEALPILSRNP
SRSTDRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKN
SILEELEKCDANHYIILFRDAGCQFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKY
SSDRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPTVPKKTQTRK
NT seq 4815 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgcgggcggtcgctctgccgccgaaggctggaggaggatggaggcacccccg
gagggcgcggacctggtgccgctggaccgctacgacgcggcgcgggccaagatcgccgcc
aacctgcagtggatctgtgcgaaggcctatggcctagacaacatccctgaggatctccga
gacccgttttacatcgaccagtatgagcaggagcacattaagccacctgttattaagctg
ctcctgtccagtgagctgtactgccgtgtctgcagcctcatcttgaaaggggaccaggca
gctaccttgcaaggacatcagtctgtcatccaggccctgtcccggaagggcatctatgtg
atggagagtgatgatacccctgtgacagatgctgatctcagccaggcacctattaagatg
agtggccacatggcgatggtggatgccctgatgatggcctatactgtggagatgatcagc
attgagaaggtggtggccagtgtcaagcgtttttctacgttcagcgcctcaaaagaactt
ccttatgaccttgaggatgccatggtgttctggatcaataaggtaaatcttaaaatgaga
gagataacagagaaagaagttaaattaaaacagcagccactggaaagtcccgctcatcaa
aagcctggcctggagcatgctgtgatgcactgcatgctggaacctgtggactttgcacgt
gtggtccgctatcggcgagaacacctctctgctaggcagtcaccctacttcccgttgttg
gaggacttgatgagagacggcagtgatggcgctgctctcttagcagtggttcactattac
tgcccagagcagatgaaactggatgacatttgcctgaaggaggtgccatcgatggctgac
agcctgtataacatccggcttctgagggagttttccaacgagcatctgaacaagtgtttc
tatctcaccctggaggatatgctgtatgctcccctagtgctgaagccaaacgttatggtt
tttatcgctgagctcttctggtggtttgagaacgtcaaacccgattttgttcagccccga
gatattcaagagctgaaggatgctaaaacggtgttacagcagaagagcagccgacctcct
gtcccgatctccaatgcaaccaagcgcagcttcctaggtagtcctgctgccatgagcccc
gctgacctgccgccatccacccagcctctcactgaaggcagtcatcggtaccacctccac
tcagaagaacctgagtgtcttgggaaaggagcctccacgtttagtccatcccatcctttg
ttgccactgagacagaagcagcagaaagtgtcacaggctgaggagatccctgatcagcga
cacagatcgaattctttaactcgggctgatggtcagccacgaggtgcagcaatagcatgg
ccagataaaaaaaacaggcctgtgtcacagccaacatcatttgctctccatcatgcagca
agttgtgatgtggaccccagttctggtgacagtatcagcttagcccgctctatcagcaaa
gatagcctagcatctaacatcatccacctgacgccacagaaccaaccccatccttctgcc
ggaaagaccaatgggaaaagcctcctgagcaacgtcaacattgaggatgatgaggaggag
gagcttgtagccatcatcaggacagatgtgtctcctcattccccagagattcccaggacc
tcacctcaggccccaggcttggtggcaagtatcaggtctccccagagacaggcagacact
ttggagagtaagcctgacagtttttacttagagcccctgatgccagcagtactccggcca
gccaaagagaaacagattatcactaaggaagatgagcgcggagaagggaggccaaggacc
atcatggccaagaggcctagtgagggctcccagcctctggtacggaagaaagtgactggt
agtcatggtagtcgtgacctgaacagaactttcaccccaattccttgttcagaatttgct
gcgagcattgatcctacagaggtgggaccacagtcaacagaagccacaggggaaggacag
cctctggctctgggtagatttgatccagtacctcaggggcaggttgctgatggcttcttt
ctccatgtaggcagggccgaggaagatgaggggaggtggtatgttggttcacagagtccc
agctcccatgactctgaaccctggaccatcctgaggcaggactcggactccgatgtggtg
gatgtagaggatgcagagcaggattttattggtgaggaccatcctgtagtcatccccaga
tacgctggtgaggaagaatcagccaagctacaagaggatatgaaagtgaaggagcacgaa
gacaaggatgacgctagtggccgctcgagcccttgtctgagcacgacttctcagctcagc
agcatgtccatggccagtggaagtgtgaagatgaccagttttgctgaaagaaaactgcag
cggctcaacagctgcgagaccaagtccagcaccagcagctcccagaagaccaccccagat
gcctcggaaagctgcccagcccctctgacaacatggcgtcagaagagggagcagagcccc
agccggcacagcaaggaccccgccagcctgctggcttctgagctggtgcagcttcacatg
cagctggaggagaagcgcagagccattgaagctcagaagaaaaagatggaggcgctgtct
gcacggcagcgtctgaagctggggaaggcggcttttctgcacgtggtgaaaaaagggaag
gctgatggtgccccacagccactgagacccgaacacttcacgaaggaattcacacaacac
aatggggaggacttggatgacggcacttgtaaaactgaagggttccttgtcaaagaagag
cagagagatctcagtgactctcaggatgtggcatttgtccagctccataaacccagggac
ccagctactctgcatgacggagagaagcacagagtgatttctgctgctctcctagaggac
agtgttggtgaggtagacgtgaatgaatgtgacctgtccattgagaagctcaacgagacc
atcagtacactgcagcaggccatattgaagatctcccagcagcaagagcagcttctcatg
aagtcccctacagtgccaacatcaggcactaaaaacaactgccaggaccaaaaagtaaag
gccccagtccactttgttgagccgctctctccaactggggtgcctggccaccgcaaaccc
ccacggctcggccagggccgcaattcccgctcaggaaggccagctgaactgaaggttcca
aaagacaggcagcagggttgttctcggagcaaaacaccaacacccagtgtggagacactc
ccacattcaaggtctttacccccaagcacccatccacggtcacccttggacccaggtggg
gaactccctgagaagtgtctctttgacagttacaggctccatgatgagagtaaccatcgg
acatttggtctgtcctcttgtaaagatgccaacatcgtatcagaacagatgaactttaaa
gagggtctggatacaagtgtccaagaggcagagctgagctcctctgccatcacagggaaa
gagcatactcccatggaggagccgctgaggagcaaggccagcctcattgaggtggacctc
tctgacctgaaggcccctgatgaggatggagaggtggttggacatgagagctcgctggag
cttggtggagagagtgaccagaagcctggggttggcttcttcttcaaggatgaacagaaa
gcagaggatgagcttgctaagaagcgggcagccttccttctgaaacagcagcgcaaggct
gaagaggctcgtgcacgcaagcagcagctggaggcggaagtggagctcaagcgagatgaa
gcccggcgtaaggccgaagaggaccgattacggaaggaggaggagaaggcgaggcgagag
ctcattaaacaggagtacttgcggaggaagcagcagcaagccttggaggagcaagggctt
ggcaaacctaaatcaaagcctaaaaagcctcggccaaagtcagttcaccgggaggagtct
tgcagcgactctggcaccaagtgctcttctaccccagataacttgagccagactcactct
ggctctagcctgtccttggcatctgcagcaacgacagaacctgaaagtgttcactcgggg
ggcacaccttctcaccgagttgaatcactggaagccttacctatcctgagtcgcaacccc
agtcggagcacagaccgagactgggagactgcatcggcagcttcctctttggcctctgtg
gccgagtacacaggtcctaaactgtttaaggagcccagtagcaaatcaaacaaaccaatt
attcacaacgccatctcccactgctgtctggctggaaaagtgaatgaacctcacaagaat
tcaatattggaggagctggagaagtgtgacgccaaccactatatcatcctgttccgagac
gccggctgccagttcagggctctttactgctaccagcccgacactgaagagatctacaaa
ctcactggcacggggcccaagagcatcaccaagaagatgattgacaaactgtataaatac
agctcagaccggaagcagtttaacctgatcccagccaagaccatgtctgtcagcgtggat
gcactcacgatccataaccacttgtggcagcccaagcggcccacagtgccaaagaagacc
cagactcgtaagtga

DBGET integrated database retrieval system