KEGG   Rattus norvegicus (rat): 29659
Entry
29659             CDS       T01003                                 
Symbol
P2rx4
Name
(RefSeq) P2X purinoceptor 4
  KO
K05218  P2X purinoceptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29659 (P2rx4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29659 (P2rx4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29659 (P2rx4)
Ion channels [BR:rno04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   29659 (P2rx4)
SSDB
Motif
Pfam: P2X_receptor Dickkopf_N
Other DBs
NCBI-GeneID: 29659
NCBI-ProteinID: NP_113782
RGD: 62073
Ensembl: ENSRNOG00000001300
UniProt: P51577
Structure
Position
12:complement(33844609..33862265)
AA seq 388 aa
MAGCCSVLGSFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSV
VSSVTTKAKGVAVTNTSQLGFRIWDVADYVIPAQEENSLFIMTNMIVTVNQTQSTCPEIP
DKTSICNSDADCTPGSVDTHSSGVATGRCVPFNESVKTCEVAAWCPVENDVGVPTPAFLK
AAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNAQTDPFCPIFRLGTIVEDAG
HSFQEMAVEGGIMGIQIKWDCNLDRAASLCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYY
RDLAGKEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYC
MKKKYYYRDKKYKYVEDYEQGLSGEMNQ
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggcgggctgctgctccgtgctcgggtccttcctgttcgagtacgacacgccgcgcatc
gtgctcatccgcagccgtaaagtggggctcatgaaccgcgcggtgcagctgctcatcctg
gcttacgtcatcgggtgggtgttcgtgtgggaaaagggctaccaggaaacggactccgtg
gtcagctcggtgacaaccaaagccaaaggtgtggctgtgaccaacacctctcagcttgga
ttccggatctgggacgtggcggactatgtgattccagctcaggaggaaaactccctcttc
atcatgaccaacatgatcgtcaccgtgaaccagacacagagcacctgtccagagattcct
gataagaccagcatttgtaattcagacgccgactgcactcctggctccgtggacacccac
agcagtggagttgcgactggaagatgtgttcctttcaatgagtctgtgaagacctgtgag
gtggctgcatggtgcccggtggagaacgacgttggcgtgccaacgccggctttcttaaag
gctgcagaaaacttcaccctcttggtaaagaacaacatctggtaccccaagtttaacttc
agcaagaggaacatcctccccaacatcaccacgtcctacctcaaatcgtgcatttacaat
gctcaaacggatcccttctgccccatattccgtcttggcacaatcgtggaggacgcggga
catagcttccaggagatggcagttgagggaggcatcatgggtatccagatcaagtgggac
tgcaacctggatagagccgcctccctttgcctgcccagatattccttccggcgcctggac
acccgggacctggaacacaatgtgtctcctggctacaatttcaggtttgccaagtactac
agggacctggccggcaaagagcagcgcacactcaccaaggcgtacggcatccgctttgac
atcatcgtgtttggaaaggctgggaagtttgacatcatccctaccatgatcaatgttggc
tctggcttggcgctcctcggggtggcgacggtgctctgtgacgtcatagtcctctactgc
atgaagaagaaatactactaccgggacaagaaatataagtatgtggaagactacgagcag
ggtctttcgggggagatgaaccagtga

DBGET integrated database retrieval system