KEGG   Rattus norvegicus (rat): 296601Help
Entry
296601            CDS       T01003                                 

Gene name
Tmem8c, RGD1306074
Definition
(RefSeq) transmembrane protein 8C
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 296601
NCBI-ProteinID: NP_001127989
RGD: 1306074
Ensembl: ENSRNOG00000006142
UniProt: D3ZQN5
Position
3p12
AA seq 228 aa AA seqDB search
MGLHLRSQLLPLRPGHVLRPAAAQGQQEGWERRGPRQADLLHSLLHLCLTVAPLLQAPAF
LSGSPAVSPGILPTLSQWNVHEEWPPLHPERPAGLLQSAKCCLGTHEFCVHQLLHSIQEK
KERELYPPRLHNHRCALQSPRPVSIGPKSQPSSVHNSSIRVIYFPGPACQDCLPFLGNWD
CPFYPCPGPESSQFRELDPVSPVPVWTQAWCPCLSPIPSAVFRSSHSQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgggattacacctacgttcacagcttctaccactgcgccctggccatgtccttcgtcct
gctgctgcccaaggtcaacaagaaggctgggaacgcaggggaccccgccaagctgacctt
ctccactctctgctgcacttgtgtctgacagtagcccccctgctccaggcccctgccttc
ctgtctggcagccctgctgtctctcccgggatacttcctacactttcccagtggaatgtc
catgaggaatggcctcctctgcaccccgagagaccagcagggctgctgcagtcggcgaag
tgctgcttagggacccacgaattctgtgttcaccagttgcttcactctattcaggaaaaa
aaagagagagaactttatcccccaaggctgcataaccataggtgtgccttgcagagccct
aggccagtcagtattggccccaagtcacaacccagcagtgtacacaacagcagcatacgg
gttatctatttcccaggccctgcctgccaggattgtctgcctttcctaggaaactgggat
tgccctttctacccctgcccaggccctgaaagctcccagtttcgggagctggacccagtg
agcccagttccagtctggacccaggcttggtgcccctgcctgagtcccatcccttcagca
gtttttcggtcgagccactcacagtaa

DBGET integrated database retrieval system