KEGG   Rattus norvegicus (rat): 29662Help
Entry
29662             CDS       T01003                                 

Gene name
Gdi2, Gdi3
Definition
(RefSeq) GDP dissociation inhibitor 2
  KO
K17255  Rab GDP dissociation inhibitor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29662 (Gdi2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   29662 (Gdi2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDI DUF2312
Motif
Other DBs
NCBI-GeneID: 29662
NCBI-ProteinID: NP_058972
RGD: 61802
Ensembl: ENSRNOG00000018091
UniProt: P50399
Position
17q12.2
AA seq 445 aa AA seqDB search
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPG
QPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKKTSMRDVYKKFDLGQD
VIDFTGHSLALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETK
EPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDI
YKRMTGSEFDFEEMKRKKNDIYGED
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggaatacgacgtgatcgtgctgggcaccggcctgacggaatgtatcctgtcg
gggataatgtcagtgaatggaaagaaggttcttcatatggatcagaacccatactatgga
ggagaaagtgcatctataacaccgctggaagatttatacaaaagatttaaattaccagga
caaccaccagcatcgatggggagaggaagagactggaatgttgacttaattcccaagttc
cttatggccaatggtcagttggtgaagatgctgcttttcacagaggtcactcgttatatg
gacttcaaagtgatcgaagggagctttgtctacaagggagggaaaatctacaaggttcct
tccactgaagcagaagccctggcgtctagcttaatgggactgtttgagaaacgccgcttc
aggaagttcctagtttatgttgccaactttgatgaaaaagatcctagaacttttgagggt
gtggatcctaagaagacctccatgagagatgtgtataagaagtttgatttgggccaggat
gttatagactttactggccattctcttgcattgtacagaacagatgactacttagaccag
ccatgttgtgaaacgattaacagaattaaactttacagcgagtctttggcaagatatggt
aaaagcccatacctctatccactttatggtcttggggaattgccacaaggatttgcaagg
ttaagtgctatatatggaggtacctacatgttgaataagccaattgaagaaatcattgtg
caaaatggaaaagtggttggcgtgaaatctgaaggagagattgctcgctgtaagcagctc
atctgtgatcccagctatgtcaaggatcgggttgaaaaagtaggccaggtaatcagagtg
atctgtatccttagccaccccatcaagaacaccaacgatgctaactcctgccagatcatc
attccacagaaccaagtcaaccgcaagtcagatatctatgtttgcatgatctcctttgca
cataatgtggcagcacagggcaagtatattgccattgtaagtacaactgtggagactaag
gaaccagagaaagaaatcagaccagctttggagctcttggaaccaattgaacaaaaattt
gtcagcatcagcgacctctttgtacctaaagatttgggaacagatagtcagatctttatt
tcccgtgcctatgatgctaccacacactttgagacaacctgtgatgacatcaaagatatc
tataagaggatgacagggtctgagtttgactttgaagaaatgaagcgcaagaagaatgac
atttatggagaagactaa

DBGET integrated database retrieval system