KEGG   Rattus norvegicus (rat): 29665
Entry
29665             CDS       T01003                                 

Symbol
P2rx7
Name
(RefSeq) P2X purinoceptor 7
  KO
K05220  P2X purinoceptor 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29665 (P2rx7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29665 (P2rx7)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    29665 (P2rx7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29665 (P2rx7)
Ion channels [BR:rno04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   29665 (P2rx7)
SSDB
Motif
Pfam: P2X_receptor Keratin_matx Ribosomal_L5_C
Other DBs
NCBI-GeneID: 29665
NCBI-ProteinID: NP_062129
RGD: 3241
Ensembl: ENSRNOG00000001296
UniProt: Q64663
Structure
PDB: 
6U9V 6U9W

Position
12
AA seq 595 aa
MPACCSWNDVFQYETNKVTRIQSVNYGTIKWILHMTVFSYVSFALMSDKLYQRKEPLISS
VHTKVKGVAEVTENVTEGGVTKLVHGIFDTADYTLPLQGNSFFVMTNYLKSEGQEQKLCP
EYPSRGKQCHSDQGCIKGWMDPQSKGIQTGRCIPYDQKRKTCEIFAWCPAEEGKEAPRPA
LLRSAENFTVLIKNNIDFPGHNYTTRNILPGMNISCTFHKTWNPQCPIFRLGDIFQEIGE
NFTEVAVQGGIMGIEIYWDCNLDSWSHRCQPKYSFRRLDDKYTNESLFPGYNFRYAKYYK
ENGMEKRTLIKAFGVRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVCIDLIINTYAS
TCCRSRVYPSCKCCEPCAVNEYYYRKKCEPIVEPKPTLKYVSFVDEPHIWMVDQQLLGKS
LQDVKGQEVPRPQTDFLELSRLSLSLHHSPPIPGQPEEMQLLQIEAVPRSRDSPDWCQCG
NCLPSQLPENRRALEELCCRRKPGQCITTSELFSKIVLSREALQLLLLYQEPLLALEGEA
INSKLRHCAYRSYATWRFVSQDMADFAILPSCCRWKIRKEFPKTQGQYSGFKYPY
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgccggcttgctgcagctggaacgatgtctttcagtatgagacaaacaaagtcacccgg
atccagagcgtgaattacggcaccatcaagtggatcttgcacatgaccgtcttttcctac
gttagctttgctttgatgagcgacaagctatatcagcggaaggagccccttatcagctct
gtgcacaccaaggtcaaaggcgttgcagaggtgacagagaatgtcacggagggcggggtg
acgaagttagtacacggcatcttcgacacggccgactacaccctccctttgcaggggaac
tcgttctttgtaatgacaaattatctcaagtcagaaggccaagaacagaagctgtgtcct
gagtatcccagccgcggtaaacagtgccattctgaccagggttgtataaaaggatggatg
gacccacaaagtaaaggaatccagaccggcaggtgtataccttacgaccagaagaggaag
acctgtgaaatctttgcctggtgtcctgctgaggaagggaaagaagccccccggcctgca
ctcttgaggagcgccgaaaacttcaccgtactcatcaagaacaatatcgacttcccgggc
cacaactatactacgagaaacatcttaccaggtatgaacatctcttgtacctttcacaag
acttggaaccctcagtgtcccatcttccggctaggggacatcttccaggaaatcggagag
aactttacagaggtggcagttcagggaggaatcatgggcattgagatctactgggactgc
aacctggacagctggtcccatcgctgtcaacccaaatacagcttccgccggctggacgac
aagtacaccaatgagtccctgttccctggctacaacttcagatacgccaagtactataag
gaaaatggcatggaaaagcggacattgatcaaagccttcggcgtgcgttttgacatcctg
gtttttggcactggaggaaagtttgacatcatccagttggttgtgtacattggatccacc
ctgtcctatttcggtttggccaccgtgtgtattgacttgatcatcaacacgtatgccagt
acctgctgcaggtcacgtgtttacccctcctgtaagtgctgcgagccctgtgcagtgaat
gagtactactacagaaagaagtgtgagcccatcgtggagcccaagccgacgttaaagtat
gtgtcctttgtggacgagccccacatttggatggtggaccagcagctgcttgggaaaagt
ctgcaagatgtcaaaggtcaagaggtcccgagaccccagacggacttcttggaactgtct
aggctctccctctctctccaccactcacccccaattcctggacaacctgaggaaatgcag
ctgctccagatagaagcggttcctaggtccagggacagcccagattggtgccagtgtgga
aactgcctcccgtctcaactaccagagaaccgcagggccctggaggagctgtgctgccgg
aggaagccaggacagtgcatcactacctctgagctcttcagtaagatcgtgctatccaga
gaggccctgcagctcctcctgctctaccaggagcccttgctggcgctggagggagaggcc
atcaacagcaagctgcgacactgtgcgtacaggagctatgccacctggcgctttgtctcc
caagacatggccgactttgccattctgcccagctgctgccgctggaagatccggaaggag
ttccccaagacccaggggcagtacagtggcttcaagtatccctactga

DBGET integrated database retrieval system