KEGG   Rattus norvegicus (rat): 296654Help
Entry
296654            CDS       T01003                                 

Gene name
Gsn
Definition
(RefSeq) gelsolin
  KO
K05768  gelsolin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    296654 (Gsn)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    296654 (Gsn)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    296654 (Gsn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    296654 (Gsn)
   04147 Exosome [BR:rno04147]
    296654 (Gsn)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     296654 (Gsn)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   296654 (Gsn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gelsolin
Motif
Other DBs
NCBI-GeneID: 296654
NCBI-ProteinID: NP_001004080
RGD: 1303089
Ensembl: ENSRNOG00000018991
UniProt: Q68FP1
Position
3p11
AA seq 780 aa AA seqDB search
MAPYCSSLRSALLVLALCALSPSHAATASRGRAQERAPQSRVSETRPSTMVVEHPEFLKA
GKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQ
DESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFQGYFKSGLKYKKGGVASGFKHVVPN
EVVVQRLFQVKGRRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQ
VSKGIRDNERSGRAQVHVSEEGSEPEAMLQVLGPKPDLPQGTEDTAKEDAANRRLAKLYK
VSNSGGSMSVSLVADENPFAQSALRSEDCFILDHGRDGKIFVWKGKQANMDERKAALKTA
SDFISKMQYPRQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGPGLSYLSSHIANVERVPF
DAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVLVDPATYGQFYGGDSYIILYNYRH
GGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGK
PMIIYKGGTSRDGGQTTPASTRLFQVRASSSGATRAVEVMPKAGALNSNDAFVLKTPSAA
YLWVGTGASDAEKTGALELLKVLRAQHVQVEEGSEPDGFWEALGGKTAYRTSPRLKDKKM
DAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTE
ALTSAKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDDDYWSVDPLDRALAELAA
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggctccgtattgctcctcgctgcgctctgcgctgctcgtcctggcgctgtgcgcactg
tcgccgtcccatgcagccaccgcatcgcggggcagggcccaagagagggcgccccaaagt
cgggtgtctgagacgcggcccagcaccatggtggtggagcaccccgaattcctgaaggca
gggaaggagcctggcctgcagatctggcgtgtggagaagtttgacctggtgcctgtgccc
cccaacctctatggagacttcttcacgggtgacgcctatgtcatcctaaagacggtgcag
ctgaggaatgggaatctgcagtatgacctccactattggctgggcaacgagtgcagccag
gacgagagcggggctgccgccatctttaccgtgcagctggatgactacctgaatggccgg
gctgtacagcaccgtgaggttcagggctttgagtcgtccacattccaaggctacttcaag
tctggacttaagtacaagaaaggaggcgtggcatctggattcaaacacgtggtacccaac
gaggtggtggtgcagaggctcttccaggtcaagggacgccgtgtagtccgtgccactgaa
gtacctgtgtcctgggacagtttcaacaacggtgactgcttcattctggacctgggaaat
aatatctatcagtggtgtggctccggcagcaacaagtttgaaagactgaaggccacgcag
gtgtccaagggcatccgggacaacgagaggagtggacgcgcccaagtacatgtgtctgaa
gagggtagcgagccggaagccatgctccaggtgctgggccccaagccggatctgcctcag
ggcaccgaggacacagccaaggaagatgctgccaaccgaaggctggccaagctctacaag
gtctccaacagtggaggcagcatgtcagtctccctcgtggctgacgagaaccccttcgcc
cagtccgccctgagatccgaggactgtttcatcctggaccacggcagagatgggaaaatc
tttgtttggaaaggcaagcaggccaacatggatgagcggaaggctgccctcaaaacagcc
tctgacttcatctccaagatgcagtaccccaggcagacccaggtttcagtcctcccggag
ggcggcgagactcctctctttaagcagttcttcaagaactggcgggacccagaccagaca
gacggccctggcctgagctacctctccagccacattgccaacgtggagcgcgtgcctttc
gatgctgctacactgcacacctccactgccatggctgcccagcacggcatggatgatgac
ggaactggccagaaacagatctggagaattgaaggttccaacaaggtactggtggacccc
gccacatatggccagttctatggaggtgacagctacatcattctgtacaactaccgccat
ggtggccgccagggacagatcatctacaactggcagggtgcccagtctacccaggatgag
gtcgctgcttcagccatcctgactgcccagctggatgaggaactgggaggaactcctgtc
cagagccgagtggtccaaggcaaagagcctgcacacctcatgagcttgtttggtgggaag
cccatgatcatctacaagggcggcacctcccgagatggtgggcagacaacccctgccagt
acccgcctcttccaagtccgggccagcagctctggagccaccagggctgttgaggtaatg
cctaaggctggcgctctcaactccaatgatgcctttgtgctgaaaaccccctccgccgcc
tacctgtgggtgggtacaggagccagtgatgcggagaagaccggcgccctggagctgctg
aaggtgctgagggcccagcacgtgcaggtggaggaaggcagtgaaccagatggcttctgg
gaggctctgggcgggaagactgcctaccgcacatcccccaggcttaaggacaagaagatg
gatgctcatcctcctcgcctcttcgcctgctccaacaggatcgggcgctttgtgatcgaa
gaggttcctggcgagcttatgcaggaagacctggctactgatgacgtcatgctcctggac
acctgggaccaggtctttgtctgggttggaaaggactctcaggaagaggaaaagacagaa
gccttgacctctgctaagcggtacatcgagacggacccagcgaatcgggacaggcggacc
cccatcactgtcgttaggcaaggctttgagcctccttcctttgtgggctggttcctcggc
tgggatgatgactactggtcggtggatcccttggaccgggccttggctgagctggctgcc
tga

DBGET integrated database retrieval system