KEGG   Rattus norvegicus (rat): 296655
Entry
296655            CDS       T01003                                 

Gene name
Stom
Definition
(RefSeq) stomatin
  KO
K17286  erythrocyte band 7 integral membrane protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    296655 (Stom)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   296655 (Stom)
SSDB
Motif
Pfam: Band_7 Band_7_1 GP68
Other DBs
NCBI-GeneID: 296655
NCBI-ProteinID: NP_001011965
RGD: 1305109
Ensembl: ENSRNOG00000019147
UniProt: Q5XI04
Position
3p11
AA seq 284 aa
MSDKRQSGHVQSQRVPESFRDNSKAELGPCGWILVAVSFIFVLITFPISIWICIKIVKEY
ERVIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEVLTKDSVTISVDG
VVYYRVQNATLAVANITNADSATRLLAQTTLRNALGTKNLSQILSDREEIAHHMQSTLDD
ATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASMV
ITESPAALQLRYLQTLTTIAAEKNSTIVFPLPIDMLQGIMGSHH
NT seq 855 nt   +upstreamnt  +downstreamnt
atgtctgacaaacgccagtccggccatgtccagtctcagcgggtccccgagtccttcagg
gataattccaaggcagaactgggaccatgtggatggattttggtggctgtctcgttcatc
ttcgtgcttataactttcccaatatcaatttggatttgcataaagattgtgaaggagtat
gaaagagtgatcatcttcagactgggccgcattttgcaaggtggcgccaaaggacctggg
ttgtttttcatcctgccgtgcactgacagcttcatcaaggtggacatgaggaccatctcc
ttcgatattccgccacaggaggtgctcactaaggactcggtgaccatcagcgtggatggt
gtggtctattaccgtgttcagaacgcaaccctggctgtggcaaatatcaccaatgcagat
tcggcaacccgtcttttggcgcaaactaccctcaggaatgcgctgggcaccaagaacctg
tctcagatcctctctgacagagaagagatcgcacaccacatgcagagtacgctggatgac
gccacagatgactggggaataaaggtcgagcgtgtggagattaaggacgtgaagctgcca
gtacagctccagagagccatggctgcagaggcagaagccgcccgggaggctagagccaag
gtgattgcagccgaaggggaaatgaatgcatccagggctctgaaagaagcatccatggtt
atcacggagtctcctgctgcccttcagctccggtaccttcaaaccctgaccactatcgct
gcggagaaaaactccaccattgtcttccctctgcccatcgacatgttgcagggcatcatg
ggttcccaccactga

DBGET integrated database retrieval system