KEGG   Rattus norvegicus (rat): 29666
Entry
29666             CDS       T01003                                 

Gene name
Psmb6, Psmb6l
Definition
(RefSeq) proteasome subunit beta 6
  KO
K02738  20S proteasome subunit beta 1 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29666 (Psmb6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29666 (Psmb6)
   05012 Parkinson disease
    29666 (Psmb6)
   05014 Amyotrophic lateral sclerosis
    29666 (Psmb6)
   05016 Huntington disease
    29666 (Psmb6)
   05017 Spinocerebellar ataxia
    29666 (Psmb6)
   05020 Prion disease
    29666 (Psmb6)
   05022 Pathways of neurodegeneration - multiple diseases
    29666 (Psmb6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29666 (Psmb6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29666 (Psmb6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29666 (Psmb6)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29666 (Psmb6)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    29666 (Psmb6)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 29666
NCBI-ProteinID: NP_476440
RGD: 61881
Ensembl: ENSRNOG00000019551
UniProt: P28073
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
10q24
AA seq 238 aa
MAAALAVRGAVSAPAFGPEALTPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIA
NRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMC
YRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGM
TKDECLQFTANALALAMERDGSSGGVIRLAAIQQSGVERQVLLGDQIPKVTISTLPPP
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggccgccttagctgttcgtggagccgtctctgcaccggcctttgggccggaggcg
ctcactccagactgggaaaaccgagaagtctccacagggaccacgatcatggctgtgcaa
tttgacgggggcgtggttctaggagcagactccagaacaaccactgggtcgtacatcgcc
aatcgagtgactgacaagctgacccctatccacgatcacatcttctgctgccgctcaggc
tcggcagctgatacccaagcagtagctgatgctgtcacgtaccagcttggtttccacagt
attgagctgaacgagcctccactagtgcacacagctgccagtctctttaaggagatgtgt
taccgctacagagaagatctgatggcaggaatcatcatcgcaggctgggaccctcaagaa
ggagggcaggtgtactctgttcccatgggaggtatgatggtaagacagtcctttgccatc
ggaggctccgggagctcatatatctatggctatgttgatgctacctatcgggaaggcatg
accaaggatgaatgtctgcaattcactgccaatgctcttgctttggctatggaacgggat
ggctccagtggaggagtgatccgcttggcagccattcaacagtcgggggtagagcggcag
gtgcttttgggagaccagatccccaaggtcaccatctccactttgccacctccctga

DBGET integrated database retrieval system