KEGG   Rattus norvegicus (rat): 29667Help
Entry
29667             CDS       T01003                                 

Gene name
Srsf5, HRS, SRp40, Sfrs5
Definition
(RefSeq) serine and arginine rich splicing factor 5
  KO
K12893  splicing factor, arginine/serine-rich 4/5/6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    29667 (Srsf5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    29667 (Srsf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    29667 (Srsf5)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   SR proteins
    29667 (Srsf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 29667
NCBI-ProteinID: NP_001182434
RGD: 3664
Ensembl: ENSRNOG00000005513
UniProt: Q09167
Position
6q24
AA seq 269 aa AA seqDB search
MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGK
ELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVS
WQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGS
KRHRSRSRSRSRTRSSSRSRSRSRSRRSKSYSRSRSRSRSRSKSRSGSRSPVPEKSQKRG
SSSRSKSPASVDRQRSRSRSRSRSVDSGN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctgtcgagtgttcattgggagactaaatcccgcagcgagggagaaagatgtg
gaaagattcttcaagggttacggacggatcagagatattgatttgaaaagaggttttggt
tttgtggaatttgaggacccaagggatgcagatgacgctgtttatgaacttgatgggaag
gaactttgcagtgaaagggttactattgaacatgctcgggctcggtctcgaggtggaaga
ggtagaggacgatactccgaccgttttagcagtcgcagacctcgaaatgatagacgaaat
gctccacctgtaagaacagaaaatcgacttatagttgagaatttatcctcaagagtcagc
tggcaggatctcaaagatttcatgagacaagctggggaagtaacctttgcggatgcacat
cgacctaaactaaatgaaggggtagttgagtttgcctcttatggtgacttaaagaatgct
attgagaaactttctggaaaggaaattaatgggagaaaaatcaaattaattgaaggcagc
aaaagacacaggtcaagaagcaggtcacgatctcggaccaggagttcctctaggtcccgt
agccgatcccgttcacgcaggagcaagtcttacagccgatcaaggagcaggagccggagc
cggagcaagtcccgttctggtagtaggtctcccgtgcctgagaagagccagaaacgtggt
tcttcgagtagatctaaatctccagcatctgtggatcgccagaggtcccgatcccggtcc
aggtccagatcagttgacagtggcaattaa

DBGET integrated database retrieval system