KEGG   Rattus norvegicus (rat): 29668
Entry
29668             CDS       T01003                                 

Gene name
Psma1
Definition
(RefSeq) proteasome subunit alpha 1
  KO
K02725  20S proteasome subunit alpha 6 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29668 (Psma1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29668 (Psma1)
   05012 Parkinson disease
    29668 (Psma1)
   05014 Amyotrophic lateral sclerosis
    29668 (Psma1)
   05016 Huntington disease
    29668 (Psma1)
   05017 Spinocerebellar ataxia
    29668 (Psma1)
   05020 Prion disease
    29668 (Psma1)
   05022 Pathways of neurodegeneration - multiple diseases
    29668 (Psma1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29668 (Psma1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29668 (Psma1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29668 (Psma1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29668 (Psma1)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29668 (Psma1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    29668 (Psma1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29668 (Psma1)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 29668
NCBI-ProteinID: NP_058974
RGD: 61841
Ensembl: ENSRNOG00000011745
UniProt: P18420
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
1q34
AA seq 263 aa
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHVFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
QCNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERP
QRKAQPSQAADEPAEKADEPMEH
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtttcgcaaccagtatgacaacgatgtcactgtttggagccctcagggcaggattcat
caaatcgaatatgcaatggaagctgtaaagcaaggctcagcgacagtcggcctgaagtcg
aagacacatgcagtgctggtcgcgctgaagagagcacagtcagagcttgccgctcaccag
aagaaaattctccacgttgacaaccatattggtatctcaattgcgggtctaactgctgat
gccagactgttatgtaactttatgcgccaggagtgtttggattccagatttgtatttgac
agaccacttcccgtatctcgccttgtgtctctaattggaagcaagacccagataccaaca
cagcgatatggccggagaccgtatggtgttgggctgctcattgctggttatgatgacatg
ggccctcacgttttccaaacctgcccatctgctaactattttgactgcagagctatgtcc
atcggagcccgttcccagtcagctcgcacttacctggagagacacatgtctgaatttatg
cagtgcaatttggatgaactggttaagcatggtcttcgcgccttaagagaaacactccct
gcagaacaggacctgaccacaaagaatgtttccattgggattgttggtaaagacttggaa
tttactatctatgatgatgatgatgtgtctccattcctggatggtcttgaagaaagacca
cagagaaaagcacagccttcacaggctgctgatgaacctgcagaaaaagctgatgaacca
atggaacattaa

DBGET integrated database retrieval system