KEGG   Rattus norvegicus (rat): 29670Help
Entry
29670             CDS       T01003                                 

Gene name
Psma3, Psma3l
Definition
(RefSeq) proteasome subunit alpha 3
  KO
K02727  20S proteasome subunit alpha 7 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29670 (Psma3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29670 (Psma3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29670 (Psma3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29670 (Psma3)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29670 (Psma3)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    29670 (Psma3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Proteasome_A_N
Motif
Other DBs
NCBI-GeneID: 29670
NCBI-ProteinID: NP_058976
RGD: 61844
Ensembl: ENSRNOG00000007851
Vega: OTTRNOG00000001114
UniProt: P18422
Structure
PDB: 

Position
6q24
AA seq 255 aa AA seqDB search
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDVREEAEKYA
KESLKEEDESDDDNM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagctccattggcactgggtatgacctgtcagcctctacattctctcctgatggaaga
gttttccaagttgaatatgctatgaaggctgtggaaaacagtagtacagctattgggatc
agatgtaaagatggtgttgtgtttggggtagaaaaactagtcctttctaaactttatgaa
gaaggctccaataaacgtcttttcaatgttgatcgacatgttggaatggcagtggcaggt
ttgttggcagatgctcgttccttggcagacatagcaagagaagaagcgtccaactttagg
tctaactttggctataacattcctctaaaacatcttgcagacagagtggccatgtatgta
cacgcgtatacactctacagtgctgttagaccttttggctgcagtttcatgttggggtct
tacagtgtgaatgatggtgcacagctctatatgatcgatccatcaggtgtttcatatggt
tactggggctgtgccattggcaaagccaggcaagctgcaaagacagaaatagaaaagctt
cagatgaaggaaatgacctgccgtgatgtagttaaagaagttgcaaaaataatttacata
gtacatgatgaagttaaggataaagcttttgaactagagctcagctgggttggtgaatta
actaaaggaagacatgaaattgttcccaaagacgtaagagaggaagcagagaaatatgcc
aaggaatctttgaaggaagaagatgaatcagatgacgacaatatgtaa

DBGET integrated database retrieval system