KEGG   Rattus norvegicus (rat): 29671Help
Entry
29671             CDS       T01003                                 

Gene name
Psma4
Definition
(RefSeq) proteasome subunit alpha 4
  KO
K02728  20S proteasome subunit alpha 3 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29671 (Psma4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    29671 (Psma4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29671 (Psma4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29671 (Psma4)
Peptidases [BR:rno01002]
 Threonine Peptidases
  Family T1: proteasome family
   29671 (Psma4)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    29671 (Psma4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Proteasome_A_N TRP_N Phenol_monoox
Motif
Other DBs
NCBI-GeneID: 29671
NCBI-ProteinID: NP_058977
RGD: 61846
Ensembl: ENSRNOG00000013493
Vega: OTTRNOG00000002260
UniProt: P21670
Structure
PDB: 

Position
8q24
AA seq 261 aa AA seqDB search
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQREKDK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaagatatgactccaggaccacaatattttctccagaaggtcgcttataccaa
gtggaatatgccatggaagccattggacacgcaggcacttgtttgggaattttagccaat
gatggcgttctgcttgcagcagagaggcgcaacatccacaagcttcttgatgaagtcttt
ttttctgagaaaatttataaacttaacgaggacatggcttgcagtgtggcaggcataaca
tctgatgccaacgttctgactaatgaactcaggctcattgctcaaaggtacttattacag
tatcaggagccaattccctgtgagcagttggttacagcactgtgtgatatcaaacaggcg
tacacacagtttggaggcaaacgtccctttggtgtttctttgctgtatattggctgggat
aagcactatggctttcagctctatcagagtgacccaagtggaaactacgggggatggaaa
gccacatgcattggaaacaacagtgctgcagcggtatcaatgctgaaacaagactacaaa
gaaggagaaatgactctgaagtcagcgctggctctggctgtcaaggtgctaaacaagaca
atggatgttagtaaactgtcagctgaaaaagtggaaatcgccacactaacaagagagaat
ggaaagaccgtgatcagagtcctcaagcaaaaggaagtggaacagttgatcaaaaaacat
gaagaggaagaagcgaaagctgaacgggagaagaaagaaaaagaacagagagaaaaggat
aaatag

DBGET integrated database retrieval system