KEGG   Rattus norvegicus (rat): 296731Help
Entry
296731            CDS       T01003                                 

Gene name
Nub1, BS4, NYREN18
Definition
(RefSeq) negative regulator of ubiquitin-like proteins 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Ubiquitin_5 UBA RuvA_C TPR_12 HOIP-UBA TPR_2
Motif
Other DBs
NCBI-GeneID: 296731
NCBI-ProteinID: NP_001013947
RGD: 1359489
Ensembl: ENSRNOG00000009282
UniProt: Q5XIT4
Position
4q11
AA seq 613 aa AA seqDB search
MAQKKYLQAKLTQFLREDRIQLWKPPYTEENKEVGLALKDLAKRYSERLECCENEVENII
EEIRCKAIERGTGNEHYRTTGIATIEVFLPPRLRKDKKSLLETRLHVTGRDLRSKIAETF
GFQENYIKIVINKKQLQLGKSLEEQGVTHNVKAMVLELKQSEEDVRRNLQLEEEEQNEAE
QKEKRIQRTKRGLEILAERAEMVVDPETMPYLDIANQTGRSIRIPPSERKALMLAMGYHE
KGRAFLKRKEYGIALPCLLDADRYFCECKELLDTVDNYAVLQLDIVWCYFRLEQLECLDD
AEKKLNLAQTCFTNCYGENHQRLVNIKGNCGKEKVLFLRLYLLQGIRNYHSGNGEEAREY
LNKARQLFKELYIDPSKVHNLLQLGFTAQEARLGLRACDGNVDHAATHISNRREELAQIR
KEEKEKRKRRLESVNTLRGMGYSTQAAKQALHQARGNLDDALKILLSNPHMWWLQDSDSE
NNSRQASPSQESIDQLVYMGFDTVVAEAALRVFAGNVQLAAQTLAHHGGSLPPDLQFSGE
DSSSTPSTSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEVIIAEYL
SYVDRTSSATKDN
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaagaaatatcttcaagcaaaactgacccagtttctaagggaagacagaatt
caactttggaaacctccatatactgaagaaaataaagaagttggtttggccttaaaggac
cttgctaagaggtactccgagcggctagagtgctgtgaaaatgaagtggaaaacataata
gaggaaatccgatgcaaagcgattgagcgcggcactgggaatgagcactaccgcacaact
gggattgctacgattgaggtgttcctgcctccgaggctccggaaagataagaaaagcttg
ttggagacccgcttgcatgtcactggtagagacctgaggagtaaaatagctgaaaccttt
ggatttcaagaaaattacatcaagatcgtaataaataagaaacagcttcaactagggaaa
agccttgaagagcaaggagtcactcacaatgtgaaggccatggtgttggagctgaaacag
tctgaagaggatgtgaggagaaacctgcagctggaggaggaggaacagaacgaggctgag
cagaaggagaaacgcattcagaggaccaaaaggggactggagatcctggccgagagagct
gagatggtggtagacccggaaacgatgccttacttagacattgcgaaccagactggcagg
tcaatcagaattcccccttcagaaagaaaagccctaatgttagccatggggtaccatgag
aagggcagggctttcctgaaaagaaaagagtatgggatagccttgccatgccttctggac
gccgacagatacttctgtgagtgcaaagagctgctggacactgtggacaactatgcagtc
ctccagctggacatcgtgtggtgctacttccgcctggaacagctggagtgccttgatgat
gcagagaaaaagctgaacttggcccagacgtgctttacaaactgttacggggagaatcac
cagagactggtcaacataaaagggaactgtgggaaagagaaggtgttgtttttaagactc
tacttgcttcagggaatccgaaactatcacagtggaaatggagaggaggctcgggaatat
ctcaacaaggcacgtcagctctttaaagagctgtacatcgacccatcgaaagttcacaac
ttgttacagttggggttcactgcccaggaagcacggctgggcctgcgggcctgtgatggg
aacgtggaccacgcagccactcacatttccaaccgcagagaggaactggcccagatacgg
aaggaagagaaggagaagaggaaacgccgtctggaaagtgtcaacactttgagaggaatg
ggctactccacacaagctgccaaacaagcccttcaccaggccagaggcaacctggacgat
gccctgaagattctcctcagcaacccccacatgtggtggttacaggattcagactctgag
aacaacagccggcaagcaagcccttcccaagaaagcatcgaccagctggtgtacatgggc
ttcgacacagtggtggccgaagctgcgctgagggtgtttgcaggcaatgtccagctggca
gctcagaccctggcacaccatggaggaagcctccctcctgacctacagttctcaggagag
gactcctcctccaccccatccacatccccgtctgactccgcagggacctctagtgcctcc
acggatgaggacatggagacagaggccgtgaacgaaatcctggaggacattccggagcac
gaggaagactacctggactccacactggaggacgaagaagtcatcatcgctgagtacctg
tcctacgtggacaggaccagttctgccacaaaggacaactga

DBGET integrated database retrieval system