KEGG   Rattus norvegicus (rat): 296751Help
Entry
296751            CDS       T01003                                 

Gene name
Pus7, RGD1307054
Definition
(RefSeq) pseudouridylate synthase 7
  KO
K06176  tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    296751 (Pus7)
Enzymes [BR:rno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     296751 (Pus7)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    296751 (Pus7)
 Prokaryotic type
    296751 (Pus7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TruD R3H
Motif
Other DBs
NCBI-GeneID: 296751
NCBI-ProteinID: NP_001164060
RGD: 1307054
Ensembl: ENSRNOG00000010572
UniProt: D4ADZ9
Position
4q11
AA seq 660 aa AA seqDB search
MEMTSVSLKRGCLVVEDNDSVTPHEETKKQKVSEGCVTNSPDGVESDSLHSSETKPGPPE
AESTLKDGENSGAQVQEEEEEEEEEDGLSEAGEEEEPESFADMMKHGLTELDVGITKFVS
PHQGFSGILKERYSDFVVHEIGKDGRISHLDDLSVPVDEEDPPEDALTVLTAEDRQQLEE
LQLFKNKETSVAIEVIEDTKEKRTIIHQAIKSLFPGLETKTEEREGKRYIVAYHAAGKKA
LANPRKHSWPKSRGSYCHFVLYKENKDTMDAINVLSKYLRVKPNIFSYMGTKDKRAITVQ
EIAVLKISAQRLAHLNKCLMNFKLGNFSYQKTPLKLGELQGNHFTVVLRNITGTDEQVQQ
AMHSLQQTGFINYYGMQRFGTTAVPTYQVGRAILQNSWTEVMDLILKPRSGAEKGYLVKC
REEWAKTKDPASALKKLPVKRCVEGQLLRGLSKYGLKNIVSAFGIIPRNNRLMYIHSYQS
YVWNSMVSRRIELYGLKPVPGDLVLKGATATYIEEDDINNYSIHDVVMPLPGFDVIYPKH
KISEAYREMLAADNLDIDNMRHTIRDYSLSGAYRKIIIRPQSVSWEVVAYDDPKIPLFNT
DVDNLEGKPPPVFASEGRYRALKMDFSLPPSTYATMAIREVLKMDTSIKNQTQLNTSWLR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggagatgacaagtgtgtccctgaaacgcgggtgcctcgttgtggaagataacgacagt
gtgaccccacatgaggagacgaagaaacagaaggtgtctgagggctgtgtgaccaacagt
ccggacggggtggagagtgacagtcttcacagcagtgagaccaagccggggcccccagaa
gcggaaagcaccttgaaagatggcgagaactccggtgctcaggtgcaggaggaagaggag
gaggaggaggaagaggacggcctttcggaggcaggggaagaggaggagccagagagcttt
gcggacatgatgaagcatgggctcaccgaacttgatgtgggcatcaccaagttcgtgagt
cctcatcagggcttctcggggatcttaaaagaaagatactctgacttcgtggttcatgaa
atcgggaaggatgggcggatcagccatttggatgacttatctgttccagtggacgaagag
gaccctccagaagatgccctcactgtcttgacagctgaggacaggcagcagttggaggag
ctccagcttttcaaaaataaagaaaccagtgttgccatcgaggtcattgaggacaccaaa
gagaaacgaaccatcatccatcaagccattaaatctctcttcccaggactagagacaaaa
acagaggagagagaggggaagagatacattgtagcctaccatgctgctggcaagaaggct
ttggcaaatccaagaaaacattcttggccaaaatcccggggaagttactgccactttgtt
ctctacaaggaaaacaaagacaccatggacgccatcaatgtgttgtccaagtatctgcgg
gtaaaaccaaacatattctcctatatgggaaccaaagacaaaagggctatcacagtccag
gagatcgctgttctcaaaataagtgcacaaaggcttgcccacctgaataagtgcctgatg
aactttaagttaggcaatttcagctatcagaaaacccctctgaagttaggagagcttcaa
ggaaaccacttcactgtcgttctcaggaatataacgggaacggatgaacaagtgcagcaa
gccatgcattcgctgcagcagaccggcttcatcaactactacggcatgcagaggtttggg
accacggctgttcctacgtaccaggtcggaagagcaattctacagaattcctggacagaa
gtcatggatttaatactgaaaccccgctctggagctgagaagggttacttggtgaaatgc
agagaagagtgggccaagaccaaagacccagcctctgccctcaaaaagctacccgtcaaa
aggtgtgtggaagggcagctgcttcgaggactttcaaagtatggactgaagaatatagtc
tctgcgtttggcataataccaagaaacaaccgcttaatgtacatccacagctaccagagt
tatgtgtggaatagcatggtgagcaggagaatcgagctgtatgggctgaagcctgtgccg
ggggacctcgtgctcaaaggagccacggccacctatattgaggaagatgacattaataac
tactccattcacgatgtggtgatgcctttgcctggctttgatgtcatctaccccaaacat
aaaattagcgaggcctacagggaaatgcttgccgcagacaaccttgatattgacaacatg
agacacacgattcgagattactccttatcgggggcctaccgaaagatcatcatccgacct
cagagcgtcagctgggaagtggttgcatacgatgatcccaaaattccacttttcaacacg
gatgtggacaacctcgaggggaaaccaccaccagtctttgcttctgaaggcagatacagg
gctctgaagatggacttctctcttcctccctctacttacgccaccatggccattcgagaa
gtgctcaaaatggacaccagcatcaagaaccagacccagctaaacacgagctggctgcga
tga

DBGET integrated database retrieval system