KEGG   Rattus norvegicus (rat): 29676
Entry
29676             CDS       T01003                                 
Symbol
Psmb3
Name
(RefSeq) proteasome subunit beta type-3
  KO
K02735  20S proteasome subunit beta 3 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29676 (Psmb3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29676 (Psmb3)
   05012 Parkinson disease
    29676 (Psmb3)
   05014 Amyotrophic lateral sclerosis
    29676 (Psmb3)
   05016 Huntington disease
    29676 (Psmb3)
   05017 Spinocerebellar ataxia
    29676 (Psmb3)
   05020 Prion disease
    29676 (Psmb3)
   05022 Pathways of neurodegeneration - multiple diseases
    29676 (Psmb3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29676 (Psmb3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29676 (Psmb3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     29676 (Psmb3)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   29676 (Psmb3)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    29676 (Psmb3)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 29676
NCBI-ProteinID: NP_058981
RGD: 61875
Ensembl: ENSRNOG00000052730
UniProt: P40112 A6HIL9
Structure
Position
10:82697425..82704521
AA seq 205 aa
MSVMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtctgttatgtcctataatggaggggccgtcatggccatgaagggaaagaactgtgtg
gccatcgctgcagacaggcgtttcggaatccaggcccaaatggtgaccacggacttccag
aagatctttcccatgggtgacaggctctacataggcctggccggcctggccactgacgtc
cagacagttgcccagcgtctcaagttccgactgaacctgtacgagctgaaggaaggacgg
cagatcaagccttacaccctgatgagcatggtggccaacctcttgtatgagaaacggttt
ggtccctactacacagaacctgtcattgctggcttggacccgaagacctttaagcccttc
atttgctctctggacctcattggctgtcccatggtgacagatgacttcgtagtcagtggc
acctgctctgaacaaatgtatgggatgtgtgagtctctctgggagcccaacatggatcca
gagcacctgtttgagaccatttctcaggccatgctgaatgctgtggacagggatgccgtg
tcgggcatgggcgtcattgtccacatcattgaaaaagacaagatcaccaccaggacactg
aaggcgcggatggactaa

DBGET integrated database retrieval system