KEGG   Rattus norvegicus (rat): 296789
Entry
296789            CDS       T01003                                 

Gene name
Sema3e
Definition
(RefSeq) semaphorin 3E
  KO
K06840  semaphorin 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    296789 (Sema3e)
SSDB
Motif
Pfam: Sema ig V-set Ig_3 Ig_6 Ig_2 I-set PSI
Other DBs
NCBI-GeneID: 296789
NCBI-ProteinID: NP_001100049
RGD: 1310973
Ensembl: ENSRNOG00000006631
UniProt: D3Z8E2
Position
4q12
AA seq 775 aa
MAPTGHILTLLLWGHLLELWTPGYTANPSYPRLRLSHKELLELNRTSIFQSPFGFLDLHT
MLLDEYQERLFVGGRDLVYSLNLERVSDGYREIYWPSTAVKVEECIMKGKDANECANYVR
VLHHYNRTHLLTCATGAFDPHCAFIRVGHHSEDPLFHLESHRSERGRGRCPFDPNSSFVS
TLVGNELFAGLYSDYWGRDSAIFRSLGKLGHIRTEHDDERLLKEPKFVGSYMIPDNEDPE
DNKMYFFFTEKALEAENNAHTIYTRVGRLCVNDMGGQRILVNKWSTFLKARLVCSVPGMN
GIDTHFDELEDVFLLPTRDPKNPVIFGLFNTTSNIFRGHAVCVYHMSSIREAFNGPYAHK
EGPEYHWSLYEGKVPYPRPGSCASKVNGGKYGSTKDYPDDAIRFARMHPLMYQPIKPVHK
KPILVKTDGKYNLRQLAVDRVEAEDGQYDVLFIGTDTGIVLKVITIYNQETEWMEEVILE
ELQIFKDPAPIISMEISSKRQQLYIGSASAVAQVRFHHCDMYGSACADCCLARDPYCAWD
GISCSRYYPTGAHSKRRFRRQDVRHGNAAQQCFGQQFVGDALDRTEERLAYGIESNSTLL
ECTPRSLQAKVVWFVQKGRDVRKEEVKTDDRVVKMDLGLLFLRVRKSDAGTYFCQTVEHS
FVHTVRKITLEVVEEHKVEGMFHKDREEEKHHKMPCPPLTGMSQGTKPWYKEFLQLIGYS
NFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYANPQEKRLRSKAEHFRLPRHTLVS
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggcaccgaccggacacatcctcaccttgctgctctggggtcacctgctggagctctgg
accccaggttacactgcgaacccctcctatcccaggctacgactgtctcataaagaactc
ttggaactgaacaggacgtcaatatttcaaagcccctttggttttcttgatctccacaca
atgctgctggatgagtatcaagaacggctctttgtgggaggcagagaccttgtctattcc
ctgaacttggaacgcgtcagtgatggctacagagagatatactggcctagcacagcagta
aaagtagaagaatgcataatgaaaggaaaagacgcaaatgagtgtgccaattatgtccgg
gttttgcatcactacaacaggacacaccttctgacctgtgctacgggagcctttgatcca
cactgtgcctttatccgagtcgggcaccattcagaggaccccctgtttcacctggagtca
cacagatctgagagaggaaggggcagatgtccttttgaccccaactcctcctttgtgtcc
acactagttggtaatgaactgtttgctgggctctacagtgactactggggccgagactca
gcgatcttccgcagcctggggaagctcggccatatccgcaccgagcatgacgatgagcgg
ctgctgaaagaaccaaaatttgtaggttcatatatgattcctgataacgaagacccagag
gacaacaaaatgtacttcttcttcactgagaaggcattggaggcagagaacaatgcccac
acgatctacacccgagtggggcggctgtgcgtgaatgacatgggaggacagagaatcctg
gtgaataagtggagcacattcctcaaagcacggctggtttgctcagtaccagggatgaat
ggaattgacacacactttgacgaattagaggatgtgtttttactgcctacccgagatccc
aagaatccagtgatatttggactatttaatactaccagcaatatttttagaggccatgct
gtatgtgtgtatcacatgtcaagtatccgggaagcctttaatggcccatatgcacataaa
gaaggccctgaatatcactggtcactgtatgaaggaaaggtcccctacccaaggcctggt
tcttgtgccagcaaagtgaatggaggaaagtacggatccaccaaagactaccctgacgac
gccatccgattcgcaaggatgcatccactaatgtatcagcccataaaacctgtccataaa
aaaccaatactggtaaaaacggatggaaaatataacctgaggcaactagcagtggaccga
gtggaagcggaggatggccagtatgacgttttatttattggaacagacacaggaatcgtg
ctgaaagtaatcacaatttacaaccaagaaacagagtggatggaggaagtcattctggag
gaacttcaaatattcaaggatccagcccctatcatttctatggagatttcttcaaagagg
caacagctctatattgggtcagcctctgctgtggcacaagtcagattccatcactgtgac
atgtacggcagcgcctgtgctgactgctgcctggctcgagacccttactgtgcctgggat
ggtatctcctgctccaggtactacccgacaggtgcacactcaaagaggagattccgcagg
caggatgttcggcacggcaacgccgcccagcagtgctttgggcagcaatttgtgggagac
gctttggataggactgaagagaggctggcttatggcatagagagcaacagtactttgctg
gaatgcaccccacgatcactacaagcaaaagttgtctggtttgtacagaagggacgcgac
gtaagaaaggaagaggtaaagacggatgacagagttgttaagatggacttgggcttgctc
ttcctcagagtccgcaagtcggatgcagggacctacttttgccaaacggtagaacatagc
ttcgtccacactgtgcgcaaaatcaccttggaggtggtcgaagagcataaagtggagggg
atgtttcataaggaccgcgaagaggaaaaacatcacaagatgccctgccctcccttaact
ggtatgtctcaggggacaaaaccctggtacaaggaattcttgcagctgattggctacagc
aacttccagagagtggaagaatactgcgaaaaggtgtggtgtacagataagaagaggaaa
aagctgaaaatgtctccctccaagtggaagtatgccaacccccaggaaaagaggcttcgc
tccaaagctgagcatttccgcctgcccaggcacacgctggtctcttga

DBGET integrated database retrieval system