KEGG   Rattus norvegicus (rat): 29680
Entry
29680             CDS       T01003                                 

Gene name
Cyp11a1, Cyp11a, Cypxia1, P450(scc), P450scc
Definition
(RefSeq) cytochrome P450, family 11, subfamily a, polypeptide 1
  KO
K00498  cholesterol monooxygenase (side-chain-cleaving) [EC:1.14.15.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno01100  Metabolic pathways
rno04913  Ovarian steroidogenesis
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
Module
rno_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    29680 (Cyp11a1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    29680 (Cyp11a1)
   04925 Aldosterone synthesis and secretion
    29680 (Cyp11a1)
   04927 Cortisol synthesis and secretion
    29680 (Cyp11a1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    29680 (Cyp11a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    29680 (Cyp11a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.6  cholesterol monooxygenase (side-chain-cleaving)
     29680 (Cyp11a1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP11 family
   29680 (Cyp11a1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 29680
NCBI-ProteinID: NP_058982
RGD: 69325
Ensembl: ENSRNOG00000008074
UniProt: P14137
Position
8q24
AA seq 526 aa
MLAKGLCLRSVLVKSCQPFLSPVWQGPGLATGNGAGISSTNSPRSFNEIPSPGDNGWINL
YHFLRENGTHRIHYHHMQNFQKYGPIYREKLGNMESVYILDPKDAATLFSCEGPNPERYL
VPPWVAYHQYYQRPIGVLFKSSDAWRKDRIVLNQEVMAPDSIKNFVPLLEGVAQDFIKVL
HRRIKQQNSGKFSGDISDDLFRFAFESITSVVFGERLGMLEEIVDPESQRFIDAVYQMFH
TSVPMLNMPPDLFRLFRTKTWKDHAAAWDVIFSKADEYTQNFYWDLRQKRDFSKYPGVLY
SLLGGNKLPFKNIQANITEMLAGGVDTTSMTLQWNLYEMAHNLKVQEMLRAEVLAARRQA
QGDMAKMVQLVPLLKASIKETLRLHPISVTLQRYIVNDLVLRNYKIPAKTLVQVASYAMG
RESSFFPNPNKFDPTRWLEKSQNTTHFRYLGFGWGVRQCLGRRIAELEMTIFLINVLENF
RIEVQSIRDVGTKFNLILMPEKPIFFNFQPLKQDLGSTMPRKGDTV
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgctggcaaaaggtctttgcctgcgctcagtgctggtcaaaagctgccaacctttcctg
agccctgtgtggcagggtccagggctggccactggaaatggagctggtatctcctctacc
aacagtcctcgatccttcaatgagatcccttcccctggtgacaatggttggataaacctg
taccacttcctgagggagaacggcacacacagaatccattatcatcacatgcagaatttc
cagaagtatggccccatttacagggagaagctgggcaacatggagtcagtttacatcctg
gaccctaaggacgcagcgacactcttctcctgcgagggtcctaacccggagcgctacctt
gtgcccccctgggtggcctatcaccagtattaccagaggcccattggggtactgtttaag
agttcagatgcctggaggaaagacagaattgtcctaaaccaagaggtgatggcccctgac
tccatcaagaacttcgtgcccctgctggaaggtgtagctcaggacttcatcaaagtctta
cacagacgcatcaagcagcaaaactctggaaagttctcaggggacatcagcgatgaccta
ttccgctttgcctttgagtccatcaccagtgttgtatttggggagcgcctggggatgttg
gaggagatcgtggaccctgagtcccagcggttcatcgacgccgtctaccagatgttccac
accagtgttcccatgctcaacatgcctccagacttatttcgactctttagaactaagacc
tggaaggaccatgcagctgcctgggatgtgattttcagtaaagctgatgaatacacccag
aacttctactgggacttaaggcagaagcgagacttcagcaagtaccctggtgtcctttat
agcctcctgggaggcaacaagctgcccttcaagaacatccaggccaacatcacagagatg
ctggcaggaggggtggacacgacctccatgactctgcaatggaacctttatgaaatggca
cacaacttgaaggtacaggagatgctgcgggctgaagttctagctgcccggcgccaggcc
cagggagacatggccaagatggtccagttggtcccactcctcaaagccagcatcaaggag
acactgagactccaccccatctctgtgaccttgcagaggtatattgtgaatgacctggtg
cttcgtaattacaagattccagccaagactttggtgcaggtggctagctatgccatgggt
cgagaatccagcttctttcccaatccaaacaagtttgacccaactcgttggttggaaaaa
agccaaaacaccacgcacttccggtacttgggctttggctggggtgttcggcagtgtctg
ggccggcggattgcagaactggaaatgaccatcttcctcatcaacgtgctggaaaacttc
agaattgaagttcaaagtatccgtgatgtggggaccaagttcaacctcatcctgatgcct
gagaagcctatcttcttcaacttccagcctctcaagcaggacctgggctcaactatgccc
agaaaaggcgacactgtatga

DBGET integrated database retrieval system