KEGG   Rattus norvegicus (rat): 29681Help
Entry
29681             CDS       T01003                                 

Gene name
C1qbp, Habp1, gC1qR
Definition
(RefSeq) complement C1q binding protein
  KO
K15414  complement component 1 Q subcomponent-binding protein, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29681 (C1qbp)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   29681 (C1qbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAM33
Motif
Other DBs
NCBI-GeneID: 29681
NCBI-ProteinID: NP_062132
RGD: 2230
Ensembl: ENSRNOG00000006949
UniProt: O35796
Position
10q24
AA seq 279 aa AA seqDB search
MLPLLRCVPRALGAAATGLRASIPAPPLRHLLQPAPRPCLRPFGLLSVRAGSARRSGLLQ
PPVPCACGCGALHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLR
KVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPELTSTPNFVVEVTKTDGKKTLV
LDCHYPEDEIGHEDEAESDIFSIKEVSFQTTGDSEWRDTNYTLNTDSLDWALYDHLMDFL
ADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgctccctctgctgcgctgcgtgccccgcgccctgggtgccgccgccacgggcctccga
gcctccatcccggccccgccgcttcggcatttactgcagcccgcgccccggccatgcctc
cggcccttcggtttgctcagcgtacgagccggctccgctcggcgctctggcctcctgcag
cccccggttccctgcgcgtgcggctgcggcgctctgcacacggaaggagacaaggccttt
gttgaatttttgactgatgaaattaaggaagaaaagaagatccagaagcataagtccctt
cccaaaatgtctggagattgggagctggaagtgaacggcacggaggctaaattattgcgc
aaagttgccggagaaaagatcactgtcactttcaacattaacaatagcatccctccaacc
tttgatggtgaagaggagccctcacaggggcagaaggccgaagagcaggagccagaactg
acatcaactcccaattttgtggttgaagttacaaagactgatggcaagaagacccttgta
ctggactgccactatcctgaggacgagatcggacacgaagatgaggccgagagtgacatt
ttctctattaaggaagtgagctttcagaccactggtgactctgagtggagggatacaaac
tacacactcaacacagactccctggactgggccttgtatgaccacctaatggatttcctt
gcggaccgaggggtggataacacttttgcagatgagttggtggagctcagcacagccctg
gagcaccaggaatatatcacctttcttgaggacctcaaaagctttgtcaagagtcagtag

DBGET integrated database retrieval system