KEGG   Rattus norvegicus (rat): 296836Help
Entry
296836            CDS       T01003                                 

Gene name
Lrrd1, RGD1562785
Definition
(RefSeq) leucine-rich repeats and death domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4
Motif
Other DBs
NCBI-GeneID: 296836
NCBI-ProteinID: XP_001068373
RGD: 1562785
Ensembl: ENSRNOG00000026196
UniProt: D4AD14
Position
4q13
AA seq 855 aa AA seqDB search
MSEDGSNVEPEGLTRSESLEEPEFIDEISDPSNETSPHSGNTDFNQIYESNSSENTEQPS
ASSTSQLNGNEETNIEIPFSDTNIEEVIPLSNSESPQSSESSETNEAEEYHPVKFPIGRK
FRGRTFNGHHKGFDMESDTFTVHLDAKGLQEFPVDIVKVKYVKYLYLDKNQIKTFQGADP
GDLLGLETLSLQENGLSSIPQEIQLFHNLKVLNASYNEISHIPKELLQLGNMRQLFLNSN
HIESLPSGLENLRYLETLSLGKNRLTHIPDSLCGLKNLKTLNLEYNQLTIFSKSLCFLPK
LVSLNLTGNMIGSLPKEVRELKNLENLLMNHNKLTFLAVEIFQLLKIKELHLADNKLEAI
SPKIENFKELRLLNLDNNLLQSLPKKISHCVNLESLTLSDNNLEELPKKIRKLKNLRQLH
ANRNKMIKMAEEISHLSKIHSLEFSGNQITHVPIEIKNCKEITRVELNYNNIMYFPVGLC
ALQSLDYLSFNGNYISEIPVDLSFSKQLLHLELNKNKITIFSEHLCSLTNLEYLDLAKNQ
IRKIPHCISAMLSLHVLILSDNKFEIFPKELCSLKNLQLLDISENQLHKIPSEISKLKKI
QKLNLSNNNFTHFPAELCQLQTLEDLNISQISGKKLTRLPEEVSRMTQLKALNISNNAIK
EIPRNIGELRNLITFHASNNQINSLPSSFLSLNVLQSLDLGGNNLTDLPSAIYKLSSLKE
INFDDNPLLRPPMEICKGKQMHTITCYLQRADDRDEKILEKIFHIVANNITETKFEFLQQ
KLHMARSENSVPVKTTTPLNEGIYQALLKWKTEKRVSFTAIALKDQLFRALNMIGAYDIM
DKITALNLYTSAIKL
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagatgggagtaatgtggagcctgaaggactcactagatctgagtcactggag
gagcctgaatttattgatgaaatatcagatccctcgaatgaaacctcacctcactctgga
aatacagatttcaaccagatttatgaatcaaattcttcagagaacacagaacagccatca
gcttcctccacaagccagcttaatggaaatgaagagacaaacatagaaattccattttcg
gacactaacatagaagaggtcatcccactgtcaaactcagaaagtccgcagagctctgag
tcatcagagactaacgaggctgaagaatatcacccagtcaaattcccaattgggaggaaa
tttagaggacgaacctttaatggacaccacaaaggatttgacatggagtctgataccttt
acagttcatcttgatgccaagggtttacaagaattccctgtagacattgttaaagtcaaa
tatgtaaaatatttatatttagataagaatcaaataaaaactttccaaggggcagatcca
ggtgatctgctaggacttgaaactctgtccttgcaagaaaatggattgtcatcgattccc
caggaaattcagttgtttcacaatttaaaggtactaaatgccagttacaacgagatatca
catatccctaaagaactattacaactggggaatatgaggcaactcttcttaaatagtaat
catattgaatctttaccttctggcttagaaaatcttagatatttggaaactttaagtttg
ggtaaaaataggttaacacatataccagactctttgtgtggtttgaaaaatttgaaaact
ctcaatctggaatataaccaattaacaatattttctaaatcgctatgcttccttccaaaa
ctcgtttccctaaaccttactggaaacatgataggcagtttgccaaaagaagttagggaa
ctgaaaaatttagaaaaccttttaatgaatcacaataaacttacttttttggctgtggag
atatttcagttgctcaaaataaaagaacttcatctagctgacaataaattggaagccatt
tcacccaaaattgagaatttcaaggaactcaggctgctcaaccttgataacaatttattg
caaagcttaccaaagaaaatttcccactgcgtaaacttggaatctcttactctcagtgat
aataatttagaagaacttcctaagaaaatccgaaagcttaaaaatctgagacaactccat
gcaaacagaaataaaatgataaaaatggctgaagaaatctcacatcttagcaagatacac
agcctagagttttcaggcaatcaaatcacacatgttcctattgaaataaaaaactgcaaa
gaaataaccagagttgaattgaattataacaacataatgtatttcccagtggggttgtgt
gccttacagtcacttgactacttgagttttaatggaaattatatttcagaaatccctgtg
gatttgtcattcagtaagcagctgcttcatttagagttgaataaaaacaagatcaccata
ttttcagaacatttatgttctctcactaatcttgaatacctggatcttgctaaaaatcaa
ataaggaaaattcctcactgtatctctgctatgttatcactccatgttctcattctgtct
gataataagttcgagattttcccaaaggaactgtgttctttaaaaaacttgcaactgctt
gatatttcagaaaatcaattacataagataccttcagaaatatccaaactgaaaaagatc
cagaagttaaacttgtcaaacaataatttcacacattttcctgctgaactgtgccaactt
caaactctggaggacctgaatataagtcagataagtgggaaaaagttaacaagacttcca
gaagaggtgtctcgtatgactcaactcaaagccctcaatatttcgaacaatgcaatcaaa
gagattccaagaaatataggggagctgagaaatctcattacttttcatgcaagcaacaat
caaataaattctcttccatcgtcctttctgtctttaaacgttctacagagcctagatctt
ggaggaaacaatctgacagatttgcccagtgctatctacaaactttcatctctgaaagag
ataaattttgatgacaatcctttgctgagacctccaatggaaatctgtaaaggaaaacag
atgcatacaatcacttgctatctccagagagcagatgacagagacgagaaaatcttagag
aagatattccacatagttgccaacaatatcactgaaacaaaatttgaatttttgcaacaa
aaactacacatggcaaggtcagaaaacagcgtccctgtaaagaccactactccattaaat
gaaggaatctaccaggcattacttaagtggaaaacagagaagagggtatcattcacagct
attgccttaaaagaccaactttttcgggcactaaatatgataggtgcctatgatataatg
gacaagatcacagcgttgaacctttatacaagcgccatcaaactgtag

DBGET integrated database retrieval system