KEGG   Rattus norvegicus (rat): 296840
Entry
296840            CDS       T01003                                 

Gene name
Rbm48, RGD1310794
Definition
(RefSeq) RNA binding motif protein 48
Organism
rno  Rattus norvegicus (rat)
SSDB
Other DBs
NCBI-GeneID: 296840
NCBI-ProteinID: NP_001019417
RGD: 1310794
Ensembl: ENSRNOG00000008980
UniProt: Q561R3
Position
4q13
AA seq 371 aa
MASSDGKPGGIFDHHVQTAVCDSRAKYREGRRPRAVKVYTINLESQYLLIQGVPAVGAMK
ELVERFALYGAIEQYNALDEYPAEDFTEVYLIKFVKLQSARIAKKKMDEQSFFGGLLHVC
YAPEFETVEETRKKLEERKAYISRVTKNQDYYVTKKKPVPEQKGTKDSRQDFHAHMPGFC
TPALNTSPKNPSENSSPCLPYSCEFPLCYFASKSPCSPGEHTDKASDSCNSARNRGELQK
HRDHSAFPPKLQMNTYKTSVPCSSVQEAIATSQAVGRFMPRTTQLQERKRRRDCDRELGT
FLETNISSNEVLIGPKLPGIPTVDLQDDSLNTTANLIRSKLKEVTSSVPKPPEDNGEDVC
TSHPRKQRRRI
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcctccagtgacgggaaacccggtggcatattcgaccaccacgtccagacagctgtg
tgtgactcgcgggccaaatacagggagggccgacgccctcgcgcggtcaaggtatatacc
atcaatttggagtctcagtacttactaatacaaggagttcctgcagtgggagccatgaag
gaattagttgagagatttgctctctatggtgcgattgaacagtataatgctctagatgaa
tacccagcagaagattttacagaagtttatctcattaaatttgtgaaattacaaagtgca
aggatagctaagaaaaagatggatgaacagagtttctttggagggttacttcatgtgtgc
tatgctccagaatttgagacagttgaagaaactagaaaaaaattagaagaaagaaaggct
tatatttcaagagttactaaaaaccaagactattatgtgaccaagaagaaaccagttcca
gagcaaaaaggaacaaaagattctagacaagacttccatgcacatatgcctggattttgt
acacctgctttaaacacatctcccaagaatccttcagagaactcaagtccttgtcttcct
tactcttgtgaattccctttatgctattttgcctccaaaagcccatgttcacctggggag
cacacggacaaagcgtcagactcctgcaatagtgctaggaaccgtggtgaactgcagaag
caccgtgaccacagtgcctttcccccaaaactacagatgaacacttacaaaacttccgtc
ccttgctctagtgtgcaagaggccattgctacttcacaggcagttggcagatttatgcct
aggacaacacagctgcaggagaggaaaagacggcgagactgtgatcgtgaacttggaact
tttcttgaaacaaacataagcagtaacgaggttttgattggacctaagttaccaggtatt
cccacagtagatctgcaggatgactccttgaatacaacggcaaacttaattcggagtaaa
cttaaagaggtgacttcatctgtgccgaagcctccggaggacaatggtgaagatgtgtgt
acaagtcacccacgaaaacaaagaagaagaatctag

DBGET integrated database retrieval system