KEGG   Rattus norvegicus (rat): 296846
Entry
296846            CDS       T01003                                 

Gene name
Hepacam2, RGD1305697
Definition
(RefSeq) HEPACAM family member 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Ig_6 C2-set_2 C2-set
Other DBs
NCBI-GeneID: 296846
NCBI-ProteinID: NP_001100050
RGD: 1305697
Ensembl: ENSRNOG00000009711
UniProt: B5DEN8
Position
4q13
AA seq 463 aa
MGQDAFMELFSSMAGVSLCKIHLLLIAGSCLGLKVTVPSHTVHGIRGQALYLPVHYGFHT
PASDIQIIWLFERSHTTPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFTDEGN
YIVKVNIQGNGTLSASQKIQVTVDDPVMKPMVQFHPASGAVEYVGNITLTCRVEGGTRLV
YQWRKNGKPININSSHSFSPQNHTLRIVPATKEDIGNYTCLVSNPVSEMESDIIIPTIYY
GPYGLQVNSDKGLKVGEVFTVDLGEAVLFDCSADSYPPNTYSWIRRSANTTRVIKHGPRL
EVASDKVAQKTADYVCCAYNNITGRRDETHFTVIITSVGLEKLAQRGKSLSPLASITGIS
LFFIISMCLLFLWKKFQPYKAIRQKLEGRPESEYRKAQSFSGHEDALGDFGIYEFVAFPD
ASAVPRMSSRSAPASDGVTGQDFQGTIYEVIQHIPAQQQDDTE
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggggcaggatgctttcatggagctcttcagcagcatggctggggtctctctctgcaaa
atacaccttcttcttatagcaggttcttgcctgggactgaaggtgacggtgccatcacac
actgtccacggcatcaggggacaggccctctacctcccagtgcactatggcttccacact
ccagcatctgacatccagataatatggctgtttgaaagatcccacacaacgcccaaatac
ttgctaggctcggtaaataagtccgtggttcccgacttggaataccagcacaaattcacc
atgatgccgcccaatgcatctctcctcatcaacccgctgcagttcactgatgagggcaat
tacatcgtgaaggtcaacatccaggggaatggaactctgtctgcaagtcagaagatacaa
gtcactgttgatgatcctgtcatgaagccaatggttcagttccatcctgcttctggggct
gtggagtatgtgggcaacattaccttgacctgtcgggtagaaggaggtaccaggctggtt
taccagtggcgaaaaaatgggaagcctattaacatcaactccagccattccttttctccc
caaaaccacacccttcggattgttccagcgacaaaggaggacattggaaactatacctgc
ctcgtgtcaaacccggtcagcgagatggaaagtgatatcattattcccaccatatactat
gggccatatggacttcaggtgaattctgataaaggcctaaaagtgggagaagtattcact
gttgacctgggagaagctgtcctctttgactgttctgctgactcttatccccccaacact
tactcctggatccgaaggtctgccaatactacgcgtgtcattaagcacgggcctcgctta
gaagttgcatctgataaagtggcccagaagacggctgactacgtgtgctgcgcttacaac
aacatcacagggagacgcgatgaaactcatttcactgtcatcatcacttccgtagggctg
gagaagcttgcgcaaagggggaaatcactgtccccattagcaagtatcactggcatatcg
ctgttttttattatatccatgtgtctcctttttctgtggaaaaagtttcagccttacaag
gccataagacagaagctagaaggcagaccagagtcggaatacagaaaagctcaatcattt
tcaggccatgaagatgccctgggtgacttcgggatatacgagtttgtggctttcccagat
gcatctgctgttcccaggatgtcaagtagatctgccccagcctctgatggtgtaacaggg
caagattttcaggggacaatttatgaagtcattcaacacatccctgcacaacagcaagac
gacacagagtga

DBGET integrated database retrieval system