KEGG   Rattus norvegicus (rat): 296849Help
Entry
296849            CDS       T01003                                 

Gene name
Pdk3
Definition
(RefSeq) pyruvate dehydrogenase kinase 3
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     296849 (Pdk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   296849 (Pdk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 296849
NCBI-ProteinID: NP_001100051
RGD: 1593276
Ensembl: ENSRNOG00000012513
Vega: OTTRNOG00000000340
UniProt: B5DFI9
Position
Xq22
AA seq 415 aa AA seqDB search
MRLFYRLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPRVLDNFLHVLINIRNRHN
DVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPAH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPNKPIQVVYVPSH
LFHMLFELFKNSMRATVELYEDKKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKSNKTF
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcttctaccggctgctcaagcagccggtccccaagcagatcgagcgctactcc
cgcttctctccgtcgccgctctctatcaaacagttcctggacttcggaagggataatgca
tgtgaaaaaacttcatacatgtttctgcgcaaggagcttcctgtgcgactggctaacacc
atgagagaggttaatcttttgccggataacttgttgaaccgcccatcagtgggattagtt
cagagttggtacatgcagagcttccttgaacttttagaatatgaaaacaagagcccagaa
gatccacgcgttttagataactttctccacgttttgataaatatcagaaacagacacaat
gacgttgttcctacaatggcccaaggcgtgattgagtacaaggaaaagttcgggtttgat
ccattcattagcagtaacattcaatatttcctggatcggttttataccaaccgcatttct
ttccgcatgcttattaaccagcacacccttctgtttggtggtgacactaaccccgctcat
ccgaaacatatagggagtatcgatcccacctgtaatgtagctgatgtggtgaaagatgca
tatgaaacagccaagatgctttgtgaacagtattacctggtagctccagaactggaagtt
gaagaattcaatgccaaagcaccaaacaaacctattcaggtagtttatgtgccgtcacat
ctgtttcacatgctatttgagttgttcaagaactcgatgagagcaacagttgaactatat
gaagataaaaaagaaggctacccagctgttaaaactcttgttactctgggtaaagaagac
ttgtccattaagataagtgacctaggtggtggagtcccacttcgaaaaatagaccgtctt
tttaactacatgtactcaactgctcctcgtcccagcctggagcccacaagagctgctccc
ttggctggatttggttatggcttgccaatttctcgactgtatgccagatattttcaggga
gatctaaaactgtattccatggaaggagtgggtaccgatgctgtcatttatttgaaggcc
ctttcaagtgaatcctttgagaggctgccagttttcaataagtctgcatggcgccattac
aagaccactcctgaagctgatgactggagcaatcccagcagcgaaccaagggatgcatca
aaatacaaggctaaacaggacaagatcaagagtaataaaactttctag

DBGET integrated database retrieval system