KEGG   Rattus norvegicus (rat): 29685Help
Entry
29685             CDS       T01003                                 

Gene name
Mcm6, Mcmd6
Definition
(RefSeq) minichromosome maintenance complex component 6
  KO
K02542  DNA replication licensing factor MCM6 [EC:3.6.4.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    29685 (Mcm6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    29685 (Mcm6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    29685 (Mcm6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     29685 (Mcm6)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    29685 (Mcm6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM6_C MCM_lid MCM_N Mg_chelatase AAA_3 AAA_5 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 29685
NCBI-ProteinID: NP_058983
RGD: 61967
Ensembl: ENSRNOG00000003703
UniProt: A9CMB8
Position
13q13
AA seq 821 aa AA seqDB search
MDLAAAAEPGAGSQHPEVRDEVAEKCQKLFLDFLEEFQGSDGEIKYLQFAEELIRPERNT
LVVSFADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIKDVEQQFKYTQPSIC
RNPVCANRKRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVVLRAEAVESAQAGD
RCDFTGTLIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLA
CYVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKR
LRQRDGSGITKSSWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMETDEGPGGINGHADSPAPVNGFNGSGEDASQETVPKPSLRLGFAEY
CRISNLIVLHLRKMEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVVHRL
THYDHVLIELTQAGLKGSSEGSESYEEDPYLVVNPNYLLED
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgcagcggctgcggagcccggtgcgggaagccagcacccggaggtgcgcgat
gaggtggccgagaaatgtcagaagctgttcctagacttcctggaagagttccagggtagc
gatggagaaattaaatacttgcagttcgcagaggagctgattcgtcctgagagaaacaca
ctggttgtgagttttgcagacctggaacaatttaaccaacaactttctaccaccattcag
gaagagttctacagagtctacccttacctgtgtcgagccttgaagacctttgtcaaagac
cgaaaggagatcccttttgctaaggatttttatgttgcgttccaagacctacccactaga
cacaagattcgtgagctcacttcctccaggatcgggctactcactcgcatcagtgggcag
gtggtgcgcactcacccagtgcaccccgagcttgtgagtgggactttcctgtgcctcgac
tgccaaacagtgatcaaggacgtagagcagcagttcaaatacacacagccgagcatctgc
cgcaatccagtatgcgccaacaggaagaggttccttctagacaccaataaatcgagattc
gttgattttcaaaaggttcgtattcaagagactcaagcggagcttccccggggaagcatc
ccccggagtttggaggttgtcctgagggccgaagccgtggagtcagcccaggctggtgac
aggtgtgacttcacggggacgctgattgttgtgccggacgtctccaagcttagcacacca
ggagcacgtgcggagaccaactcccgagtcagtggcgctgacgggtatgagacagaaggc
atccgagggctccgagccctgggtgtcagagacctgtcatacaggctggtcttccttgcc
tgctatgttgcaccaaccaacccacgatttggagggaaagaactcagagatgaggagcag
acagctgagagcattaagaaccaaatgacggtgaaggaatgggaaaaggtgtttgaaatg
agtcaggacaaaaacctgtaccacaatctctgcactagcctcttccctacgatccacggc
aatgatgaagtaaaacgtggcgtcttgctgatgctgttcggtggcgttcccaagacaaca
ggggaaggaacctctcttcgtggggatataaatgtttgcattgttggggatccaagtaca
gctaagagccagtttctcaagcatgtggatgagttcagtcccagagctgtgtataccagt
ggcaaggcctccagtgctgccggcttgacagcagctgtggtgagagatgaggaatctcac
gagtttgtcatcgaggctggagcgttgatgctggctgataacggtgtctgttgcattgat
gagtttgataagatggacatgcgggaccaagttgctattcacgaagctatggagcagcag
accatatctatcactaaagccggagtgaaggcaactctgaatgccaggacatccatttta
gctgcagcaaaccctgtcagcggacactacgacaggtcaaaatctctgaaacagaacatc
aatctgtcagcgcccatcatgtcccgctttgacctcttcttcattttggtggatgagtgc
aatgaggtgacagattatgctattgccaggcgcatagtagacttgcattcgaggatcgaa
gaatcgatagaccgggtttattcccttgatgatataagaaggtatcttctcttcgcccga
cagtttaagcccaagatttccaaagagtcagaggacttcattgtggagcagtacaaacgc
ctccgccagagggatggctctgggatcaccaagtcgtcgtggagaatcactgtgagacag
cttgagagcatgatccgactctcagaatcgatggcccgcatgcactgctgtgatgaggtc
cagcctaaacatgtgaaggaagcttttcgattactgaataaatcgatcatccgtgtagaa
acgcctgacgtcaatctagatcaagaggaagagatccagatggagacggatgagggacca
ggaggcatcaatggtcatgctgacagccctgcccctgtgaacgggttcaatggctctggt
gaagatgccagtcaggagaccgttcccaagccctcccttaggctgggctttgctgaatac
tgccgaatctctaacctcatcgtgcttcacctcaggaaaatggaagaagaggaggatgag
tcagccctaaagaggagcgagctggtcaactggtacctgaaggaaatcgagtcggaaatc
gactctgaagaagagctcataaataagaagaggatcatagagaaggttgttcatcgtctc
acacactacgatcacgttctgattgagctcacccaggctggactgaaaggctccagtgaa
ggaagcgagagctatgaggaagatccttacctggtagtcaacccgaactacttgcttgaa
gattga

DBGET integrated database retrieval system