KEGG   Rattus norvegicus (rat): 29686
Entry
29686             CDS       T01003                                 

Gene name
Scn1b
Definition
(RefSeq) sodium channel subunit beta-1 isoform 1 precursor
  KO
K04845  voltage-gated sodium channel type I beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29686 (Scn1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29686 (Scn1b)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   29686 (Scn1b)
SSDB
Motif
Pfam: V-set Ig_3 DUF5326
Other DBs
NCBI-GeneID: 29686
NCBI-ProteinID: NP_001257974
RGD: 3631
Ensembl: ENSRNOG00000021102
UniProt: Q00954
Position
1
AA seq 218 aa
MGTLLALVVGAVLVSSAWGGCVEVDSETEAVYGMTFKILCISCKRRSETTAETFTEWTFR
QKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYE
CHVYRLLFFDNYEHNTSVVKKIHLEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMVY
CYKKIAAATEAAAQENASEYLAITSESKENCTGVQVAE
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggacgctgctggctctcgtggtgggcgcggtgctggtatcctcagcctgggggggc
tgcgtggaggtggattctgagaccgaggcagtgtatgggatgaccttcaaaatcctgtgt
atctcctgtaagcgtcgtagtgagaccaccgccgagaccttcacggagtggaccttccgc
cagaagggcacagaggaatttgtcaagatcctacgctatgagaatgaggtgctgcagctg
gaggaagatgagcgctttgagggccgtgtggtgtggaacggtagtcggggcaccaaggac
ctgcaggacctgtccatcttcatcaccaatgtcacctacaaccactctggcgactacgaa
tgtcacgtctaccgtctcctcttctttgataattacgagcacaacaccagcgtcgtcaag
aagatccacctggaggtggtggacaaggccaacagagatatggcatccatcgtgtcagag
atcatgatgtacgtgctcattgtggtgttaaccatatggctcgtggcggagatggtgtac
tgctacaagaagattgctgctgccacggaagctgctgcacaagagaatgcctcggaatac
ctggccattacttccgagagcaaagagaactgtacaggcgtccaggtggctgaatag

DBGET integrated database retrieval system