KEGG   Rattus norvegicus (rat): 29688Help
Entry
29688             CDS       T01003                                 

Gene name
Minpp1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    29688 (Minpp1)
   00562 Inositol phosphate metabolism
    29688 (Minpp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     29688 (Minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     29688 (Minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 29688
NCBI-ProteinID: NP_062136
RGD: 3089
Ensembl: ENSRNOG00000011287
UniProt: O35217 G3V7H2
Position
1q52
AA seq 481 aa AA seqDB search
MLRGARSHLSASVALAAVLAAALLSSFARCSLPGRGDPVASVLSPYFGTKTRYEDVNPWL
LGDPVAPRRDPELLAGTCTPVQLVALIRHGTRYPTTKQIRKLRQLQGLLQTRESVDGGSR
VAAALDQWPLWYDDWMDGQLVEKGRQDMRQLALRLAALFPDLFCRENYGRLRLITSSKHR
CVDSSAAFLQGLWQHYHPGLPPPDVSDMECDPPRVNDKLMRFFDHCEKFLTEVERNATAL
YHVEAFKTGPEMQTVLKKVAATLQVPVNNLNADLIQVAFFTCSFDLAIQGVHSPWCDVFD
VDDAKVLEYLNDLKQYWKRSYGYAINSRSSCNLFQDIFLHLDKAVEQKQRSQPVSSPVIL
QFGHAETLLPLLSLMGYFKDKEPLTAYNFEEQVHREFRSGHIVPYASNLIFVLYHCEDAQ
TPQEKFQIQMLLNEKVLPLAHSQKTVALYEDLKNHYQDILQSCQTSKECNLPKVNITSDE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcggcgcgcgcagccacctctcggcctcggtagccctcgccgcggtcctggct
gcggcgctgctctcgtcgttcgcgcgctgctctctcccggggcgcggcgacccggtggct
tcggtgcttagcccctacttcggcacgaagacacgctacgaagatgtcaacccctggctg
ctgggcgacccggtggcgccgcgacgggacccggagctgctggcggggacttgcaccccg
gtgcagctggtcgccctcatccgtcacggcacccgctaccctacgaccaagcagatccgc
aagctgaggcagctgcaggggctgctgcagacccgcgagtccgtggatggcgggagccga
gtggccgccgctctggaccaatggccgctgtggtacgatgactggatggacgggcagctg
gtggaaaaggggcggcaggacatgcgacagctggccctgcgtctggccgccctcttccct
gacctcttctgccgggagaactacggccgcctgcggctgatcaccagctccaagcaccgc
tgtgtggacagcagcgccgccttcctccaagggttgtggcaacattaccacccaggattg
ccacctcccgacgtctcagacatggagtgtgaccctccgagagttaatgataagctaatg
aggttcttcgatcactgtgagaagtttttaaccgaagtcgaaagaaacgccacggctctt
tatcatgtggaagccttcaaaaccgggccagaaatgcagacagttttaaagaaagttgca
gccactttgcaagtgccagtgaacaatttaaatgcagacttaattcaggtagcctttttc
acctgttcgtttgacctggcaattcaaggtgtccattctccctggtgcgatgtgtttgac
gtagatgatgcgaaggttctggaatacttaaatgatctgaaacagtactggaaacgaagt
tatggctatgccattaacagccggtccagctgcaacctgtttcaggacatttttctacac
ctggacaaagcagttgagcagaagcaaaggtctcagccggtctcttctccagtcatcctc
cagtttggtcatgcggagaccctcctacccctgctctcgctcatgggctacttcaaggac
aaggagcccctgacagcatacaattttgaggagcaggtgcatcgcgagttccgaagtggt
cacatcgtaccatatgcttcaaacctaatatttgtgctttaccattgtgaagacgcacag
acccctcaagaaaaattccagatacaaatgctgctgaatgaaaaggtgttacccttagct
cactcgcagaaaactgttgccttgtatgaggatctgaagaaccactaccaggacattctt
cagagctgtcaaactagtaaagaatgtaacctacccaaggtgaacatcacgtccgacgag
ctctga

DBGET integrated database retrieval system