KEGG   Rattus norvegicus (rat): 29689Help
Entry
29689             CDS       T01003                                 

Gene name
Gabrd, GABAA-RD
Definition
(RefSeq) gamma-aminobutyric acid type A receptor delta subunit
  KO
K05184  gamma-aminobutyric acid receptor subunit delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04723  Retrograde endocannabinoid signaling
rno04727  GABAergic synapse
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29689 (Gabrd)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    29689 (Gabrd)
   04723 Retrograde endocannabinoid signaling
    29689 (Gabrd)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    29689 (Gabrd)
   05033 Nicotine addiction
    29689 (Gabrd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29689 (Gabrd)
Ion channels [BR:rno04040]
 Ligand-gated channels
  GABA-A
   29689 (Gabrd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 29689
NCBI-ProteinID: NP_058985
RGD: 61901
Ensembl: ENSRNOG00000016385
UniProt: P18506
Position
5q36
AA seq 449 aa AA seqDB search
MDVLGWLLLPLLLLCTQPHHGARAMNDIGDYVGSNLEISWLPNLDGLMEGYARNFRPGIG
GPPVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLW
LPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECML
DLESYGYSSEDIVYYWSENQEQIHGLDRLQLAQFTITSYRFTTELMNFKSAGQFPRLSLH
FQLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSS
LPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADYRKKRKAKVKVTKPRAEMDVRNAI
VLFSLSAAGVSQELAISRRQGRVPGNLMGSYRSVEVEAKKEGGSRPGGPGGIRSRLKPID
ADTIDIYARAVFPAAFAAVNIIYWAAYTM
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggacgttctgggctggctgctgctgccgctccttctgctgtgcacgcagccgcaccat
ggcgccagagcaatgaatgacattggggactacgtgggctccaacctggagatatcctgg
ctccccaacctggatggactaatggagggctacgcccgaaacttccgaccaggcattgga
ggtcctccagtgaatgtggcgcttgccctagaggtggccagcattgaccacatctcagaa
gcaaatatggaatacaccatgacagtgttcctgcaccagagctggcgagacagcaggctg
tcctacaaccataccaacgagaccctgggcctggatagccgcttcgtggacaagctgtgg
ctccctgacaccttcattgtgaatgccaagtctgcctggttccatgatgtgaccgtggaa
aacaagcttatccgcctacagcccgacggtgtgattttatacagcatccgcatcacctcc
acagtggcctgtgacatggaccttgccaagtaccccatggacgagcaggagtgcatgctg
gacctggagagctatggctactcttctgaggacattgtctattattggtcagaaaaccag
gagcagatccacgggctggacaggctgcaactggcccagttcactatcaccagttaccgc
ttcaccacggagctgatgaacttcaaatcagctggccagttccctcgactcagcttacac
ttccagcttcggaggaaccggggtgtctacatcatccagtcttacatgccctctgtcctc
ctggttgccatgtcctgggtctccttctggattagccaagcagcagtgcctgccagagta
tctctaggcatcaccactgtgctgacaatgaccacactcatggttagtgcccgctcctcc
ctcccgcgggcttctgctatcaaggctctggatgtgtatttctggatctgctatgtcttc
gtgtttgctgccctggtggagtatgcatttgcccacttcaatgctgactacaggaagaaa
cggaaagccaaggtcaaggtcacgaagccaagggcagagatggacgtgaggaacgccatt
gtcctcttctccctctctgctgctggggtcagccaggagttggctatctcccgccgtcaa
ggccgggtccctgggaacctcatgggttcctataggtctgtagaagtggaggcaaagaag
gagggggggtcccgcccaggaggcccaggaggcatccgttccagactcaaacccatcgat
gcagacaccatcgacatctatgcccgcgctgtgttcccggcagcctttgcagcagtcaac
atcatctactgggcggcgtataccatgtga

DBGET integrated database retrieval system