KEGG   Rattus norvegicus (rat): 296911Help
Entry
296911            CDS       T01003                                 

Gene name
ST7
Definition
(RefSeq) suppression of tumorigenicity 7
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ST7 TPR_6 Clathrin TPR_19
Motif
Other DBs
NCBI-GeneID: 296911
NCBI-ProteinID: NP_001004102
RGD: 1303148
Ensembl: ENSRNOG00000056243
UniProt: Q2IBC9
Position
4q21
AA seq 554 aa AA seqDB search
MAEAGSGFLEQLKSCIVWSWTYLWTVWFFLVLFLVYILRVPLRINDNLSTVSMFLNTLTP
KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN
GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS
DHLRPADAIMQKAWRERNPQARISAAHEALEINECATAYILLAEEEATTIAEAEKLFKQA
LKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRLGRTREAVKMMRDLM
KEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDDISLPKSATICYTAALLKARAVSD
KFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYLLEMKSLILPPEHILKRGDSEAIA
YAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKGHLFYPYPICTETADRELLPSFHE
VSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKAFLSTLFAPLNFVMEKVE
SILPSSLWHQLTRI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcgggctcgggcttcctggagcagctcaagtcctgcatcgtgtggtcgtgg
acctatctgtggaccgtgtggttcttcctcgtgctcttcctggtctacatcctgagggtg
cccctgaggatcaacgacaatctgagcacagtgagcatgtttttgaacacgttaacccca
aagttctacgtggccctgacaggcacttcctcactaatatcgggacttattttgatattt
gaatggtggtattttcgcaagtatggaacatcgttcattgaacaagtctcagtgagccac
ttgcgcccccttctgggtggggttgacaacaactcttccaataattctaattccagtaat
ggggactcagattccaacaggcaaagtgtctcagaatgcaaagtatggcgaaatccactg
aatttgtttaggggtgctgaatacaatcggtacacttgggtcacaggacgagagcctctg
acctactatgacatgaacctctctgcccaagaccaccagaccttctttacctgtgactcg
gaccatctccgtcccgcagatgcaataatgcaaaaagcgtggagagagaggaaccctcaa
gccaggatttctgcagcccatgaagctttggagataaatgagtgtgcaactgcttatatt
ctcttggctgaagaggaagccacaactattgctgaagcagaaaagctctttaagcaggcc
ctgaaggctggagatggttgttaccggcgttctcagcagctacaacatcatggctcccag
tatgaagctcaacacagacgagacaccaatgtcttggtctatatcaaaagaaggctggca
atgtgtgcccggagacttggaaggaccagagaagccgtgaagatgatgagagatttaatg
aaggagtttcccctcttaagcatgttcaatatccatgaaaaccttctagaagctcttctg
gaactccaagcctatgcggatgttcaggcagtcttagcaaagtatgatgatataagctta
ccaaagtcggcaacaatatgctacacagcggccctgctcaaagcaagagctgtctctgac
aaattctctccagaggctgcatctcggcgggggctgagcacagcagagatgaatgcagta
gaagccattcacagagctgtggaatttaatccacacgtgccaaaatatctgctagaaatg
aaaagcttaatcctcccaccagagcacatcctgaagagaggagacagtgaagcaatagca
tatgcattctttcatcttgcacactggaagagggtggaaggggctttgaatctcttgcat
tgtacgtgggaaggcactttccggatgatcccatatcctctggagaaggggcacctattt
tatccatacccaatctgtacagagacagctgaccgggagctacttccctctttccatgaa
gtctcagtttacccaaagaaggaacttcccttcttcatcctcttcactgctggattgtgt
tccttcacagccatgctggccctcctgacacatcagtttccggaacttatgggagtcttc
gcaaaagctttcctcagcactttgtttgcccccttgaactttgttatggagaaagtggaa
agcatcctcccctccagtttgtggcatcagctaacacggatctga

DBGET integrated database retrieval system