KEGG   Rattus norvegicus (rat): 296935Help
Entry
296935            CDS       T01003                                 

Gene name
Lmod2
Definition
(RefSeq) leiomodin 2
  KO
K22030  leiomodin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    296935 (Lmod2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     296935 (Lmod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomodulin WH2 LRR_6 Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 296935
NCBI-ProteinID: NP_001094434
RGD: 1592092
Ensembl: ENSRNOG00000045831
UniProt: A1A5Q0
Position
4q22
AA seq 549 aa AA seqDB search
MSTFGYRRGLSKYESIDEDELLASLTAEELKELERELEDIEPDRNLPVGLRQKSLTEKTP
TGNFSREALMAYWEKESQKLLEKERLGECGKLAEEDKEESEEELIFTESNSEVSEEVCTE
EEEESTEEEEEEEEEDSEEEEVTTEVTKHINGTVSHNGVNPDNSKPKTFKSQIENINLTN
GNSGGTQRNTESPAAIHPCGNPTVIEDALEKIKNNDPDTTEVNLNNIENITTQTLSRFAE
ALKENTVVKTFSLANTHADDAAAIAIAEMLKVNEHITSVNVESNFITGKGILAIMRALQH
NTVLTELRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELPGPRMSMTSILTRNMDK
QRQKRMQEQKQQEGHDGGATLRTKVWQRGTPGSSPYASPRQSPWSSPKVSKKVHTGRSRP
PSPVAPPPPPPPPPLPPHMLPPPPPPPAPPLPGKKLITRNIAEVIKQQESAQRALQNGQR
KKKGKKVKKQPNNILKEIKNSLRSVQEKKMEESSRPSTPQRSAHENLMEAIRGSSIRQLR
RVEVPEALR
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatttggctacagaaggggacttagtaaatatgaatccatcgatgaggatgaa
cttctggcctccctcacagctgaagagctgaaggagcttgagagggagctggaagacatt
gaacctgatcgaaaccttcctgtggggctaagacaaaagagtctgacagagaaaacccca
accggaaacttcagccgagaggcgctgatggcgtactgggaaaaggagtcccaaaaactt
ttggagaaggaacggctgggggaatgtggaaagcttgcagaagaagacaaggaagagagt
gaggaggaactaatcttcacagagagcaacagcgaagtctccgaggaggtgtgtacggaa
gaggaggaggagtctacagaggaagaggaagaagaggaggaagaagacagtgaggaagag
gaagtgacgacggaagtcacaaaacatattaacggaactgtaagccacaatggtgttaat
cctgataactctaagccaaagacatttaaaagccaaatagaaaatataaatttaaccaac
ggcaacagtggaggaacacagaggaacacagagtcgccagctgccattcacccctgtggg
aatcccactgttatcgaggatgctctggaaaagattaaaaacaatgaccccgacacaaca
gaagttaatctgaacaatattgagaacatcaccacccagaccttatcccgatttgctgaa
gctctcaaggagaacacagtagtgaagacgttcagtctggccaacacgcacgctgacgac
gccgcggcgattgccattgcggaaatgctcaaggttaacgagcacattaccagcgtaaac
gtggagtccaacttcatcaccggcaaggggatcctggccatcatgagagcgctgcagcac
aacacagtgctcaccgagctgcgcttccacaaccagaggcacatcatgggctcccaggtc
gagatggagattgtcaagctgctcaaggagaataccacgctgctgaggctgggctaccat
tttgagctcccaggaccgagaatgagtatgacgagtattttaaccaggaatatggataaa
cagaggcaaaaacgcatgcaggagcaaaaacagcaagaggggcatgatggaggagctact
cttaggaccaaagtctggcaaagagggacgcctggctcttctccgtatgcatctccgagg
cagtctccatggtcgtctcctaaagtctccaagaaagtgcacaccgggaggagccgacct
ccatctcctgtggccccgcctccaccccctcccccacctccccttcctccccacatgctg
cctcctcctcctcctccccctgctcctccactcccagggaaaaagctcatcaccagaaac
attgcagaagtcattaaacaacaggaaagcgcccagcgggccctacaaaatggacagcga
aagaaaaaagggaaaaaggttaagaaacaacccaacaatatcctaaaggaaattaagaat
tctctgaggtcagtgcaagagaagaaaatggaagaaagctcccggccctctaccccacag
agatcagctcatgagaacctcatggaagccattcgggggagcagtataagacagctacgg
agggtggaagttcccgaagctctgagatag

DBGET integrated database retrieval system