KEGG   Rattus norvegicus (rat): 296936Help
Entry
296936            CDS       T01003                                 

Gene name
Iqub, RGD1562359, Trs4
Definition
(RefSeq) IQ motif and ubiquitin domain containing
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4041 IQ
Motif
Other DBs
NCBI-GeneID: 296936
NCBI-ProteinID: NP_001029302
RGD: 4145674
Ensembl: ENSRNOG00000021729
UniProt: Q45GW3
Position
4q22
AA seq 790 aa AA seqDB search
MSDTEENVLDSPASGEAAGEVISIPGPTDEAEESDISPEQEYEIEGFTTESEETVEHYSD
LSVSTPKSYDSKPRDEVVSLGSATDSHEQEYRLGDLGGDQRSEEDEMSFLYKIKAIKENL
QSSVKECIATVKIVLIPAGQEIVMPFRVDAPFRFLKEHFAHLLRIPHHVLQMAYTGISVG
NNESLIQYGVKPREIVQMNVFSSEPDQYPVRRIEGLSEGSKIITVTIQTGIERYEEVAVE
IVKSDFHKPFLGGFRHKITGLEYHNAGTQTVPKKIPEKDNLFCRDTQTVFQKKKLQQTMN
TTSTQMTKIGVYVSNMTDKLLTPGSYFSAAEYHARRLNAVIVIQTAYRRWHAKCYVDSLR
LQKKMRLEWEKEEELKKIREKEEWIRMDYYRRHNPKTTEDFELLFNALELWRQEEVTQVE
QYSSEAERKAALCELLEKETQIIASIGRHRYVAQLERQDVATQAFLDKCSASNTWRRPDG
QTVEMDTQFTIRARELQSIYKCILLKNLSQDERLDILLTLKHTVKEHECKLTQEILELID
REVDLMMRGVKSHNLEGLRKRITTLFIHYIKTPLFNPEVAKHLKVPQDPLKFYDKIYFCH
SCQMYLPSVEFSVSPTSHRVYRCRHCINLENETQRRESFLKYKCLLQRLYFSEANYEDNS
HIAYLMQLQDIKYLTENIWASQSALSAWDDLNDLVMVRWNKHVEWSPWNCILLTKDEGTA
HLKLESIEKGYGRLFIHKIKHKHILAKNYFSQVPVLASLILKDDEIEAIRSKYSTENPPK
IIVPHGIVPN
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatacggaggagaatgtccttgactccccggccagtggtgaagcggccggcgaa
gtcatcagtattcctggccctacagacgaagcagaagagtcagatatctcaccagagcaa
gaatacgaaatagagggatttaccaccgagagtgaggagacagtggagcactacagtgat
ctcagtgtttcaacccccaaatcttacgactccaaacccagggacgaggtcgtgtccctt
ggaagtgccacagactctcatgagcaagaatacagacttggagatcttggaggtgaccag
agatcagaagaggacgagatgtcatttctttataaaatcaaagctataaaggagaacttg
cagtcgtcagtgaaagagtgtatagccacagtaaaaattgtacttattcctgcaggccag
gaaattgtaatgcctttcagagttgatgctccatttagattcctcaaggagcactttgca
cacttattacgtatcccccatcatgtattgcaaatggcctatacaggaatcagtgttggg
aataatgagtccctgatacaatatggagtcaaaccacgggaaatcgttcaaatgaatgta
ttttcctcagaacccgaccaatatccagtcagaagaatagagggcttgagtgagggctcc
aagatcataacggtcaccattcagaccggcatcgaacgctacgaggaggtagctgtggag
atagtaaaatctgacttccacaagccatttcttggtggatttagacataaaataacagga
ctagaataccacaatgctgggacacaaactgtacccaagaagattccggaaaaagacaat
ctgttctgtagggacacccagacagtttttcagaaaaagaagctgcaacaaactatgaat
accacctccactcagatgactaaaatcggtgtatacgtatcaaacatgactgataaactg
ctcacgccaggaagttacttttcagctgcagagtaccacgctcgaaggttgaacgcggtg
atagtgattcagactgcctacaggcgatggcacgctaagtgctatgtcgacagcctaaga
ctacaaaagaaaatgaggttggagtgggaaaaagaggaagaacttaagaagatccgagag
aaggaagaatggatacgaatggactattaccggaggcacaatcctaaaacaaccgaagac
tttgagctccttttcaatgctctagaactttggcgtcaagaagaagtcacacaagttgag
caatattcaagtgaggctgaaaggaaagctgctctgtgcgagcttttggaaaaagagacg
cagataattgcttccatcgggagacatagatacgttgctcagttggagagacaggatgta
gctacacaagcttttctggataagtgttcagcttcaaatacctggagaagacctgatgga
caaaccgttgaaatggacacacagttcacaataagagccagagagctgcaaagcatctac
aagtgtatcctgctgaaaaacctctctcaagatgagaggctggatatactcctgacactg
aagcacactgtgaaggaacatgagtgtaaactgacccaagaaatcctagaattgattgac
agagaagttgaccttatgatgagaggagttaaatctcataatctcgaaggactcaggaaa
agaatcacaacactctttattcactatatcaaaactcctctgtttaacccagaagtcgca
aaacaccttaaggtccctcaagacccactgaagttttatgataagatttacttctgccac
agttgccaaatgtatttgccttctgtcgagttttccgtctcacccacctcgcatcgtgtg
taccgctgccggcactgcataaacctggagaatgagactcagaggcgggaatcatttttg
aaatacaagtgtttacttcagcggctctacttctcagaagccaattatgaggataactcc
cacattgcttatctaatgcagcttcaggatattaagtacttgacagagaacatctgggca
tcgcagtcggccctcagcgcctgggatgacctcaatgacctggtcatggtcaggtggaac
aaacacgtggagtggtcgccctggaactgcattctgctcaccaaggatgaaggcacagct
catctcaagctagagagcatcgagaagggatatggacgcctttttattcacaagatcaag
cacaaacatatcttggctaaaaactatttttcacaggtcccagtgctggcttcacttata
cttaaggatgatgaaatagaagctatcagaagtaaatactccacagagaatcctcctaaa
atcatagtaccccatgggattgtacctaattag

DBGET integrated database retrieval system