KEGG   Rattus norvegicus (rat): 29695
Entry
29695             CDS       T01003                                 

Gene name
Gabrr2
Definition
(RefSeq) gamma-aminobutyric acid type A receptor rho 2 subunit
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04723  Retrograde endocannabinoid signaling
rno04727  GABAergic synapse
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29695 (Gabrr2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    29695 (Gabrr2)
   04723 Retrograde endocannabinoid signaling
    29695 (Gabrr2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    29695 (Gabrr2)
   05033 Nicotine addiction
    29695 (Gabrr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29695 (Gabrr2)
Ion channels [BR:rno04040]
 Ligand-gated channels
  GABA-A
   29695 (Gabrr2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 29695
NCBI-ProteinID: NP_058988
RGD: 61902
Ensembl: ENSRNOG00000007490
UniProt: P47742
Position
5q21
AA seq 465 aa
MPYFMRLALFLFCLMALVESRKPRRKRWTGHLETSKPSHLYKKNLDVTKIRTGKPRPLLR
VEDHDFTMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWRDERLAFPSSSN
RSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNM
DFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRLA
FYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDHRAVPARVSLGIMT
VLTMSTIITGVNASMPRVSYIRAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQEQKERKLR
DKFPCTCGMLHSRTMTLDGSYSESEANSLAGYPRSHILPEEERQDKIVVHLALNSELTSS
RKKGLLKGQMGLYIFQNTHAIDKYSRLIFPAFYIVFNLIYWSVFS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgccttattttatgagactcgctttgttcttgttttgcctgatggctcttgtggagagc
agaaaacccaggaggaagagatggacagggcacctggaaacatccaagccaagtcacttg
tataaaaagaacctcgatgtgaccaagatccggacaggaaaacctcggcctctgctcagg
gtagaggaccatgacttcaccatgaggccagcctttggaggcccggccatccctgtgggt
gtggacgtgcaggtggagagtctggacagcatctccgaggtggacatggacttcaccatg
accctgtacctgaggcattactggagggatgagaggctggcctttcccagcagcagcaac
aggagcatgaccttcgatggcaggctggtgaagaagatctgggtccctgacgtcttcttt
gttcactccaaaaggtcatttacccacgacaccaccaccgacaacatcatgctgcgagtg
tttcccgatggccacgtgctgtacagcatgaggattaccgtcactgccatgtgcaacatg
gacttcagccacttccccctggactcccagacctgctctttggagctagagagctacgcg
tacacggacgaggatctgatgctgtactggaagaacggggatgagtccctgaagacggac
gagaagatctccttgtcccagtttctgatccagaagttccacacgacttccagactggcc
ttctacagcagcacgggctggtacaaccgtctgtacatcaacttcactctgcgacgtcac
atcttcttcttcttgctccaaacctactttcctgccaccctcatggtcatgctgtcctgg
gtgtccttctggatcgaccacagagctgtgcctgctagagtttcactgggcatcatgacg
gtgctgaccatgtccaccatcatcacgggcgtgaacgcctccatgcctcgagtgtcctac
atccgggccgtggacatctacctctgggtcagctttgtgttcgtgtttctctcagtgttg
gagtacgcagctgtcaactacctgaccacagtgcaggaacagaaggaacggaagcttcgg
gacaaatttccatgcacgtgtggaatgcttcattcaagaaccatgacgctggatggaagc
tacagtgaatctgaggccaacagcctggctggctacccaagaagccacattcttccagaa
gaagaaaggcaagacaaaatagtggttcatttggccctcaacagtgaattgacttcatcc
agaaagaaaggccttctcaaaggccaaatgggactctatatcttccagaacacccatgcc
attgacaaatactccaggttgatatttcctgccttctacatagttttcaacctaatttat
tggtcagtgttttcctag

DBGET integrated database retrieval system