KEGG   Rattus norvegicus (rat): 296953
Entry
296953            CDS       T01003                                 

Gene name
Irf5
Definition
(RefSeq) interferon regulatory factor 5
  KO
K09446  interferon regulatory factor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    296953 (Irf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    296953 (Irf5)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    296953 (Irf5)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 296953
NCBI-ProteinID: NP_001100056
RGD: 1310447
Ensembl: ENSRNOG00000007437
UniProt: D3ZPU1
Position
4q22
AA seq 497 aa
MNQSAPGIPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGD
NTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFQLYYDGPRDMPPQPYKIYEV
CSNGPAPTESQPTDDYVLGEEEEEEDEELQRMLPGLSITEPVLPGPPIAPYSLPKEDTKW
PPALQPPVGLGPPPPDPNLLAPPSGDSAGFRQLLPEVLEPGPLASNQPPTEQLLPDLLIS
PHMLPLTDLEIKFQYRGRPPRALTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPS
PEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCALAHGSCPNPI
QREVKTKLFSLEQFLNELILFQKGQTNTPPPFEIFFCFGEEWPDLKPREKKLITVQVVPV
AARLLLEMFSGELSWSADSIRLQISNPDLKDHMVEQFKELHHIWQSQQRLQPMVQAPPVA
GLDAGQGPWPMHPVGMQ
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgaaccagtcagccccagggattcccacaccaccccgccgtgtgaggctgaagccctgg
ctggtggcccaggtgaacagctgccagtacccagggctccagtgggtcaacggggaaaag
aaactcttctatatcccctggcgccatgctacaaggcacggtcccagccaggatggagac
aacaccatcttcaaggcctgggctaaagagacagggaagtacacggagggcgtggatgag
gctgacccagccaaatggaaggccaacctgcgctgtgcccttaacaaaagccgtgacttc
cagctgtactatgatggccctcgagacatgccacctcagccctacaagatctacgaggtc
tgctccaatggccctgctcccacagagtcccagcccacagatgattacgttctgggagaa
gaggaggaagaggaagatgaagagctccagagaatgctaccaggcctgagtatcacagaa
cctgtgctacctgggcctcccatagcaccctattccttacccaaagaagacaccaagtgg
ccacctgctctccagccacctgtagggctgggtccccctcccccagacccaaatctcctg
gcccctccctctggagattctgctggctttaggcagcttctccctgaggtcctggagcct
ggacccctggcttccaaccagccccctacagaacaactcttgcctgacctgctcatcagc
ccccacatgctgcctttgactgacctagagatcaagttccagtaccggggacgtccaccg
cgggccctcaccatcagcaacccacaaggctgcaggctcttctatagccagctagaggct
acccaggagcaagtggaactctttggccctgtgaccctggagcaagttcgcttccctagc
ccagaggatatccccagtgacaagcagcgcttctatacgaaccagctgctggatgtcctg
gaccgagggctcatcctgcagctgcagggccaggacctgtatgccatccgtctgtgccag
tgtaaggtgttctggagtgggccctgtgccttggcccatggttcctgccccaaccccatc
cagcgggaagtcaagacaaagctctttagcctagagcagtttctcaatgaactcatcctg
ttccagaagggccaaaccaataccccaccaccttttgagatcttcttttgctttggagaa
gaatggcctgacctcaaaccccgagagaagaagctcattactgtacaggtggtacctgtc
gcagcccggttgctgctggagatgttctcaggagagctttcttggtcagcagacagcatt
cggctgcagatctcaaacccggatctcaaagaccacatggtagagcagttcaaagagctc
catcacatctggcagtcccagcagcgcttgcagcccatggtccaggcccctcctgtggca
ggccttgatgctggccaggggccctggcccatgcacccagttggcatgcaatag

DBGET integrated database retrieval system