KEGG   Rattus norvegicus (rat): 296957
Entry
296957            CDS       T01003                                 

Gene name
Zc3hc1, RGD1561099
Definition
(RefSeq) zinc finger, C3HC-type containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-C3HC Rsm1
Other DBs
NCBI-GeneID: 296957
NCBI-ProteinID: NP_001120765
RGD: 1561099
Ensembl: ENSRNOG00000010154
UniProt: B2RYM6
Position
4q22
AA seq 501 aa
MAASCEGQLFAAGIEKTWGAVVRSPEGTPQKVRQLIDEGIVPEEGGTEPKDTSATFQSVD
GSPQAEQPPLESTSKEAFFHRVETFSSLKWAGKPPELSPLICAKYGWVTVECDMLKCSSC
QAFLCASLQPTFDFGRYKERCAELKKSLCSAHEKFCFWPDSPSPDRFGMLPLSEPAVLVS
EFLDRFQSLCHLDLQLPSLRPEDLTTMCLTEDKLSALLHLVEDELDFQIDDRKTTSKLGS
DIQVHATACVLSLCGWACSSLEPTQLSLITCYQCMRKVGLWGFQQMESSMTDLEASLGLT
SSPIPGAEGRPEHFPLVPESPRRMMTRSQDAAVSPSSEQSEKSPGPIVSRTRSWESSSPV
DRPELEAASPTTRSRPVTRSMGTGDSAGLEVPSSPHRRAKRPRLCSSSSSDTSPRSFFDP
TSQHRDWCPWVNITLVKETKENGKTEVEACTPAEPGWKAVMAILLAHKHSNQPAETDSMS
LSEKSRKVFRIFRQWESLCSS
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcggcttcctgtgaggggcagctgtttgccgcgggtattgaaaagacttggggtgca
gtcgttcgttcccctgaagggacaccccagaaagttcggcagctgatagatgaaggaatt
gtcccggaagaggggggcacagaaccaaaggacacatctgccacattccagtcagtcgat
gggtcgcctcaagcagaacagcctccactggaatctacaagcaaagaagccttttttcac
agagtggagaccttctcttctttgaaatgggcagggaagccccctgagctgtctccactt
atctgcgcaaaatacggttgggttacagttgaatgtgacatgctcaagtgctccagctgc
caagctttcctctgtgccagtttgcagcccacttttgactttggcagatataaggagcga
tgtgctgagctcaagaaatccttgtgcagtgcccatgagaagttctgtttttggccagac
agcccctctccagatagatttgggatgttgccattgagtgagcctgctgttcttgtcagt
gagttcctggaccggtttcaaagcctttgccatttggacctccagcttccttccctgagg
ccagaggacttgacaactatgtgcttgacagaagacaagctcagtgctctgctgcacctg
gtggaagatgagctcgatttccaaatcgatgacagaaagactacaagcaaattaggctca
gacatccaagtccacgccaccgcctgtgttctctctctgtgtggctgggcatgtagttca
ttggagcctacacagctctccctgataacgtgttaccagtgtatgaggaaggtcggtctc
tggggctttcagcagatggaatcgtccatgacagatctggaggcttcccttggtttgaca
agctcccccattccaggtgcggagggtcggcctgagcacttccctctggtgccagaatct
cctaggcggatgatgacccgaagccaagatgccgccgtttctccaagctctgagcagtct
gaaaaaagtcctggtccgattgtttcccgaacccggagttgggagtcttccagtcctgtt
gaccggcctgagctagaggcagccagtcctaccaccaggagccgcccagtgacccgaagc
atgggaaccggagattctgctggcttagaagttccctcgagccctcaccggagagctaag
cgacctcgcctttgttcttccagcagctcggacacctctccaagaagcttctttgatccc
acctctcagcatagagattggtgcccttgggtgaatatcacactggtcaaagaaaccaag
gagaatgggaaaacggaagtggaagcctgtaccccagcagagccaggctggaaggcagtg
atggccatcctgctggcccacaagcattctaaccagccagctgagaccgactccatgagt
ctctctgaaaaatcaaggaaagtgttccgaatattccggcagtgggagtctttatgctca
tcctga

DBGET integrated database retrieval system