KEGG   Rattus norvegicus (rat): 296981Help
Entry
296981            CDS       T01003                                 

Gene name
Atp6v0a4
Definition
(RefSeq) ATPase H+ transporting V0 subunit a4
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    296981 (Atp6v0a4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    296981 (Atp6v0a4)
   04142 Lysosome
    296981 (Atp6v0a4)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    296981 (Atp6v0a4)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    296981 (Atp6v0a4)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    296981 (Atp6v0a4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    296981 (Atp6v0a4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    296981 (Atp6v0a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    296981 (Atp6v0a4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   296981 (Atp6v0a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V_ATPase_I IFP_35_N
Motif
Other DBs
NCBI-GeneID: 296981
NCBI-ProteinID: NP_001100061
RGD: 1305055
Ensembl: ENSRNOG00000013428
UniProt: D4A1H0
Position
4q22
AA seq 801 aa AA seqDB search
MASVFRSEEMCLSQVFLQVEAAYCCVAELGELGLVQFKDLNANVNSFQRKFVNEVRRCES
LERILRFLEDEMQNEIIIQVPDKDPGTPLPREMITLETTLEKLEGELQEANQSHQALKKS
FLELTELKYLLKKTQDFFEVNLGFTAGVINRERMASFERLLWRVCRGNVYLKFSEMDTLL
EDPVTKEEIKKNIFIIFYQGEQLRLKIKKICDGFRATIYPCPEHAAERREMLASVNVRLE
DLITVITQTESHRQRLLQEAASNWHSWVIKVQKMKAVYHVLNMCNIDVTQQCIIAEIWFP
VADTRHIKKALEQGMELSGSSMVPIMTEVETKTDPPTFNRTNKFTAGFQNIVDAYGVGSY
REINPAPYTIITFPFLFAVMFGDCGHGMVMLMAALWMVLNERHLLAQKSTNEMWNIFFNG
RYLILLMGIFSIYTGLIYNDCFSKSFNIFGSSWSVQPMFRNGTWNAHVVEQNPYLQLDPA
IPGVYSGNPYPFGIDPIWNLASNKLTFLNSYKMKMSVILGIVHMIFGVILSLFNHIYFRR
TLNIILQFIPEMIFMLSLFGYLVFMIIFKWCQYDAHTSQKAPSILIHFIGMFLFDYDDSS
NAPLYGHQQEVQTFFVIIALVSVPWMLLIKPFILRAKHQKSQLQSFTIHEDAMEGPSVKK
TAGAHGTKEGHEEEFNFGDIFVHQAIHTIEYCLGCISNTASYLRLWALSLAHAELSEVLW
TMVMSIGLRLRGWGGLVGVFIIFAVFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYE
GAGFKFSPFSFKHVLEGAAEE
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgtgtttcgaagtgaggagatgtgcttatcccaagtgtttctccaggtggag
gctgcatactgctgtgtggctgagctgggggagcttggtttggttcaattcaaagatctg
aacgcaaatgtaaacagcttccagaggaagtttgtgaatgaggtccgaagatgcgagtca
ctggagagaatcctccgttttctggaagatgagatgcaaaatgagattataatccaagtg
cctgacaaggatccagggacccctctgccccgggaaatgatcaccctggagactactctg
gagaagttggaaggagagctacaggaagccaaccagagccatcaggctttgaagaagagc
tttttggaactgacagagctcaaatacctcctgaagaaaacccaggacttttttgaggta
aacttagggttcacggccggtgtgataaacagggagaggatggcttccttcgagaggctg
ctgtggagagtttgccggggaaacgtatatttgaagttcagcgagatggacacacttctg
gaggatcctgtgacgaaagaagaaattaaaaagaatatattcatcatattttatcaagga
gaacagctcaggctgaaaatcaagaagatctgtgatgggtttcgtgctaccatctacccc
tgcccggagcatgcagccgagcgcagagagatgctggccagtgtcaatgtgaggctggaa
gacttaatcactgtcattacccaaacagagtctcaccgacagcgcctactgcaggaagca
gcttccaactggcactcgtgggtcatcaaagtacagaagatgaaggccgtctaccacgtg
ctgaacatgtgcaacatcgacgtcacccagcagtgcatcattgctgagatctggttccct
gtagcagacactagacacattaagaaggccctggagcaaggcatggaactcagtggctcc
tccatggtccccatcatgacagaagtggaaactaaaacagaccctcccaccttcaatagg
accaataaatttacagctggcttccagaacattgtcgatgcatatggtgtaggtagctac
cgagagataaacccagccccctatactatcatcaccttccccttcctgttcgctgtgatg
tttggagactgtggtcacgggatggtgatgctgatggccgccctgtggatggtcctaaat
gagagacacttgctggctcagaagagcaccaatgagatgtggaacatcttcttcaatggg
cgctatctgatcctcctcatgggcatcttctccatctacaccggcttgatctacaacgac
tgtttctccaaatcttttaacatctttggctcctcttggagtgtccagcctatgttcaga
aacggcacgtggaatgctcatgtcgtggaacagaatccgtatttgcagctggatccggcc
atcccaggagtgtattctggaaatccctacccatttgggattgatccgatttggaacctg
gcttcaaacaaactcacatttttaaactcctacaagatgaagatgtcggtcatcctggga
atcgttcatatgatcttcggtgttatcctcagcctcttcaatcacatctacttcagacga
accctcaacatcattctgcagttcatccccgagatgatttttatgctgagtctgtttgga
tacctggttttcatgatcattttcaagtggtgtcaatatgatgcccacacatcccagaag
gcacccagcatcctcatccacttcatcggcatgtttctgtttgactacgatgactcgtcc
aacgcacccctgtacggccatcagcaagaagtccagactttctttgtcattatagcgttg
gtgtctgtgccgtggatgcttttgattaagccatttatccttagagccaagcaccagaaa
tctcagctgcagtccttcacgatccatgaggatgccatggagggcccctctgttaagaag
actgcaggtgcccatgggacgaaggaaggacacgaggaggagttcaactttggagacatc
tttgtccaccaagccatccacaccattgagtactgcctgggctgcatctccaatacagcc
tcatatcttcggctgtgggctctcagcttggctcacgcagagctgtccgaggtactgtgg
accatggtgatgagcatcggccttcgcctccgaggctggggagggctcgttggtgtcttc
atcatttttgccgtcttcgccgtcctcacagttgccatcctcctcgttatggagggcctc
tcagcctttctgcacgccctccggctgcattgggtggaattccagaacaagttctacgag
ggggccggcttcaagttctcccccttctcctttaagcacgtcctggaaggggcggctgag
gagtag

DBGET integrated database retrieval system