KEGG   Rattus norvegicus (rat): 296985
Entry
296985            CDS       T01003                                 

Gene name
Clec2l, RGD1565373
Definition
(RefSeq) C-type lectin domain family 2, member L
  KO
K22681  c-type lectin domain family 2 member L
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    296985 (Clec2l)
Lectins [BR:rno04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   296985 (Clec2l)
SSDB
Motif
Pfam: Lectin_C RskA UL45
Other DBs
NCBI-GeneID: 296985
NCBI-ProteinID: NP_001037698
RGD: 1565373
Ensembl: ENSRNOG00000029644
UniProt: Q0ZCA7
Position
4q22
AA seq 211 aa
MEPAREPPARARPPPPAARPAPAAPRPRSPAEAEARGPEGLLRRSGSGYEGSTSWKAALE
DTTTRLLLGAIAVLLFAILVVMSILASKGCIKCETPCPEDWLLYGRKCYYFSEEPRDWNT
GRQYCHTHEAALAVIQSQKELEFMFKFTRREPWIGLRRVGDDFHWVNGDPFDPDTFTISG
TGECVFVEPTRLVSTECLTTRPWVCSKMAYT
NT seq 636 nt   +upstreamnt  +downstreamnt
atggagccggccagagagccccccgcacgcgctcgcccgccgcccccggccgctcgcccc
gcgcccgctgcgcccaggccacgctctccagccgaggcagaggcccgaggcccagagggg
ctgctgaggcgatccgggtctggctatgagggcagcaccagctggaaggcggccttggag
gacaccaccacacgccttctgctgggagccattgcagtccttctgtttgccattctggtg
gtgatgagcatcctggcttccaagggctgcatcaagtgtgagacgccttgcccagaggac
tggctgctctacggaaggaaatgctactacttctccgaggagcctagagactggaataca
ggacggcagtactgccatacccacgaggccgcgctggctgtgatccagagccagaaagaa
ctggaatttatgttcaagttcacacggagggagccctggatcggcctgcgcagagttggg
gacgacttccactgggtcaatggggacccgtttgacccagacacattcaccatctcgggt
acgggcgagtgcgtctttgtggagcccaccaggctggtgtcaacagagtgtctgacgacc
cgtccctgggtgtgcagcaagatggcctacacgtga

DBGET integrated database retrieval system