KEGG   Rattus norvegicus (rat): 296995Help
Entry
296995            CDS       T01003                                 

Gene name
Mrps33
Definition
(RefSeq) mitochondrial ribosomal protein S33
  KO
K17411  small subunit ribosomal protein S33
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    296995 (Mrps33)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    296995 (Mrps33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP-S33 DUF4955
Motif
Other DBs
NCBI-GeneID: 296995
NCBI-ProteinID: NP_001041328
RGD: 1309217
Ensembl: ENSRNOG00000026528
UniProt: Q0ZFS4
Position
4q22
AA seq 105 aa AA seqDB search
MSLSEYAVRMSRLSARIFGEVARPTDSKSMKVVNLFSEQPLAKKKETYDWYPNHNTYFAL
MGTLRFLGLYRDEHQDFKDEQRRLKKLRGKGKPRKGEGKRATKKK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctttcagaatatgcagtgcgcatgtcccgtctgagtgcccgtatctttggtgaa
gtggccaggcctactgactcaaagtccatgaaagtggtaaacctgttcagcgagcagccc
ctggccaagaagaaagagacgtacgactggtacccgaatcacaacacgtattttgcgctc
atgggcaccctccgttttcttggcctttacagagatgagcatcaggactttaaggatgag
caaagacgtctaaagaagctccgggggaaggggaagccaaggaaaggagaagggaaaaga
gctacaaaaaagaaatag

DBGET integrated database retrieval system