KEGG   Rattus norvegicus (rat): 29702
Entry
29702             CDS       T01003                                 

Gene name
Eif2ak3
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 3 precursor
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05160  Hepatitis C
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29702 (Eif2ak3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    29702 (Eif2ak3)
   04137 Mitophagy - animal
    29702 (Eif2ak3)
  09143 Cell growth and death
   04210 Apoptosis
    29702 (Eif2ak3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    29702 (Eif2ak3)
   05162 Measles
    29702 (Eif2ak3)
   05168 Herpes simplex virus 1 infection
    29702 (Eif2ak3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29702 (Eif2ak3)
   05012 Parkinson disease
    29702 (Eif2ak3)
   05014 Amyotrophic lateral sclerosis
    29702 (Eif2ak3)
   05020 Prion disease
    29702 (Eif2ak3)
   05022 Pathways of neurodegeneration - multiple diseases
    29702 (Eif2ak3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29702 (Eif2ak3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    29702 (Eif2ak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29702 (Eif2ak3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29702 (Eif2ak3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   29702 (Eif2ak3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like PQQ_2 Kdo PQQ ABC1 APH
Other DBs
NCBI-GeneID: 29702
NCBI-ProteinID: NP_113787
RGD: 70884
Ensembl: ENSRNOG00000006069
UniProt: Q9Z1Z1
Position
4
AA seq 1108 aa
MERATQPRPRALLLLFLLLGCAAGISAVARARSLLAPTSDTAFGLGAAAAPTSAARVPAV
ATAEVTVEDAEALPAASGEQESRATESDDDVELRPRGRSLVIISTLDGRIAALDAENHGK
KQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMEAVPFTVESLLESS
YKFGDDVVLVGGKSLTTYGLSAYSGKLRYICSALGCRRWDSDEMEEEEDILLLQRTQKTV
RAVGPRSGSEKWNFSVGHFELRYIPDMETRAGFIESTFKLGGNKEDSKIISDVEEQDVDT
VIKVSVADWKVMAFSKKGGRLEWEYQFCTPIASAWLVRDGKVIPISLFDDTSYTANEEVL
EDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRVSEKFPTRPKALESVNGESAIIPLPT
IKWKPLIHSPSRTPVLVGSDEFDKCLSNDKYSHEEYSNGALSILQYPYDNGYYLPYYKRE
RNKRSTQITVRFLDSPHYSKNIRKKDPILLLHWWKEIFGTILLCIVATTFIVRRLFHPQP
HRQRKESETQCQTESKYDSVSADNSDNSWNDIKHSGYVSRYLTDFEPIQCMGRGGFGVVF
EAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLETPPEKWQE
EMDEIWLKDESTDWPLSSPSPMDAPSVKIRQMDPFSTKEQIEVIAPSPERSRSFSVGISC
GRTSSSESQFSPLEFSGTDCGDNSDSEDAAHNLQDSCLTDCDMEDGTVDGDDEGHSFELC
PSEASPYTRSREGTSSSIVFEDSGCDNASSKEDPRMNRLHNGHHYVNKLTEFKHSSSRSS
SEATLSTSPTRPTTLSLDFTRNTVDRLQPSSPKVYLYIQMQLCRKENLKDWMNRRCSMED
REHRVCLHIFLQIAEAVQFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAMDQDEEE
QTVLTPMPAYATHTGQVGTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYPFSTQMERV
RTLTDVRNLKFPPLFTQKYPQEHMMVQDMLSPSPMERPEATDIIENAVFENLEFPGKTVL
RQRSRSLSSSGTKHSRQPSSTFSPLPGN
NT seq 3327 nt   +upstreamnt  +downstreamnt
atggagcgcgccacccagccccgaccgcgcgcgctgctgctgctgttcctgctgctgggc
tgcgcggcggggatctcagcggtcgcgcgcgcccgcagcttgcttgctcccacatcggat
acggcatttggcttgggggcagcagccgcccctacttcagccgcgcgggtgcctgcggtg
gctacggccgaagtgaccgtggaagacgccgaggcattgcccgctgcctccggcgaacag
gagtcacgcgcgaccgagtccgatgacgacgtggaactgcggcctcgcggcaggtcctta
gtaatcatcagcactttagatggacgaattgccgcactggatgccgagaatcatgggaaa
aagcagtgggatttggacgtgggatctggttccttggtttcatctagccttagcaagcca
gaggtgtttgggaacaagatgatcattccttccctggacggagacctcttccagtgggac
cgagaccgagagagcatggaggccgtccctttcactgtggagtcccttctcgaatcttca
tacaagtttggagatgatgttgttctggttggaggaaagtctctgaccacatacgggctc
agtgcatatagtggaaagctgaggtatatctgttctgccttgggatgtcgccgatgggat
agtgatgaaatggaagaagaggaagacatcttgcttctgcaacgcacgcagaagactgtg
cgagctgtcgggcctcgaagcggcagtgagaagtggaatttcagtgttggccactttgaa
cttcggtatattccagacatggaaactagagccggattcattgaaagcacctttaaactg
ggtggaaacaaagaagactctaaaatcatttcagatgtggaagaacaagatgtggacaca
gtgataaaagtttccgttgctgattggaaggtcatggcgtttagtaagaagggaggccgc
ctagaatgggagtaccagttttgtactcccattgcgtctgcctggctggtgagggatggt
aaagtcatccccatcagtctgtttgatgacacaagttacacagccaatgaggaagttttg
gaagatgaagaagacattgtagaggctgctcggggagccacagagaacagcgtgtactta
gggatgtacagaggccagctgtacctgcaatcatccgtcagggtctcggaaaagttccct
acaaggccgaaggccttggagtctgtaaatggagaaagtgccattattcctctgccgacg
atcaaatggaagcccttaatccattctccgtctaggactcctgtcttggttgggtctgat
gaatttgacaagtgtctaagtaatgataaatattcccatgaagaatacagtaatggtgcg
ctttcaatcctacagtatccatatgacaacggttactatctgccttattacaagagagaa
aggaataagcggagcacgcagatcacggtcaggttcctggacagcccgcactacagcaag
aacatccgcaagaaggaccccatcctcctcctgcactggtggaaggaaatatttggaacg
atcttgctttgcattgtggccacgacctttatcgtgcgcaggcttttccatcctcagccc
cacaggcaacggaaggagtctgaaactcagtgccaaactgaaagtaaatacgactctgtg
agtgctgataacagcgacaacagctggaacgacattaaacactcaggatacgtgtcccga
tacctaacagattttgagccaattcagtgcatgggtcgaggcggctttggcgttgtcttt
gaagctaagaacaaagtagatgactgcaattacgccatcaagaggatccgtctcccaaac
agggagctggcacgggagaaggtaatgcgggaagtcaaagccttggctaagctggagcac
ccaggcatcgtgaggtatttcaatgcgtggctggaaacaccaccagagaagtggcaagag
gagatggatgaaatctggctgaaggacgaaagcacagactggccactcagctcccctagc
ccaatggatgccccatctgttaagatccggcagatggatcctttctctacaaaagaacag
attgaagtcatagctccttctcctgaaagaagtcggtctttctcagtgggcatttcctgt
ggccggacaagctcatctgagagccagttctctcccctggagttctcagggacagactgt
ggagacaacagtgactcagaggacgcagcccacaacctccaggacagctgcctgacagat
tgcgacatggaagatggtacagtggacggcgatgatgagggacactcctttgaactttgt
ccttctgaagcttctccctataccaggtcaagggagggaacgtcctcttccatagtgttt
gaagactctggctgtgataatgcgtccagtaaggaggaccccagaatgaatcggctgcat
aatggccaccattacgttaataagctaactgagttcaagcactccagcagcaggtcttct
tccgaagccaccttgtctacctctcctaccaggccaaccaccctaagtttagatttcacc
aggaacacggtggaccggctccagcccagctcccccaaggtgtacctgtacatccagatg
cagctgtgcaggaaggagaaccttaaagactggatgaaccggcgctgcagcatggaggac
agggagcacagagtgtgcctgcacatctttctgcagatcgcagaggcagtgcagtttctg
cacagcaagggactcatgcacagggacctcaagccttccaacatattcttcacaatggat
gatgtggtcaaagttggggactttgggctagtgactgcaatggaccaggatgaagaagag
cagacagtactgactccaatgccagcctatgctacacacacgggacaagtcgggaccaag
ctgtacatgagcccagaacagattcatggaaacaactactcccataaagtggacatcttc
tctttaggcttgattctgtttgaactcctttacccattcagcactcagatggaacgagtt
aggactttaactgatgtaagaaatctcaagtttccaccactgttcactcagaaatatccc
caagagcatatgatggttcaagacatgctttctccatcccccatggagcggcctgaagcc
acagacatcattgaaaatgctgtgtttgagaacttggagtttcctgggaaaacggttctg
agacagcggtcccgctccttgagttcatccggaactaaacattccagacagcccagcagc
acattcagcccactgcctggcaactag

DBGET integrated database retrieval system