KEGG   Rattus norvegicus (rat): 29704Help
Entry
29704             CDS       T01003                                 

Gene name
Pacsin1
Definition
(RefSeq) protein kinase C and casein kinase substrate in neurons 1
  KO
K20123  protein kinase C and casein kinase substrate in neurons protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29704 (Pacsin1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    29704 (Pacsin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FCH SH3_9 SH3_1 SH3_2 DUF2605 PilJ
Motif
Other DBs
NCBI-GeneID: 29704
NCBI-ProteinID: NP_058990
RGD: 3247
Ensembl: ENSRNOG00000054603
UniProt: Q9Z0W5
Position
20p12
AA seq 441 aa AA seqDB search
MSGPYDEASEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDW
AKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHK
QIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSV
TPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLV
FLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFE
EWNPDLPHTAAKKEKQPKKAEGAALSNATGAVESTSQAGDRGSVSSYDRGQAYATEWSDD
ESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGW
CRGRLDSGQLGLYPANYVEAI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcccctacgatgaggcctcggaggagatcacagatagcttctgggaggtgggg
aactacaagcggacggtgaagcgcatcgacgatgggcaccgcttgtgcaacgacctcatg
agctgcgtgcaggagcgcgccaagatcgagaaggcatacgcgcagcagctcaccgactgg
gccaagcgctggcgccagctcatcgagaaaggtccccagtatggcagcctggagcgggcc
tggggcgccatgatgactgaggcagacaaagtcagcgagctgcaccaggaggtgaagaac
agcctactgaacgaggacctggagaaagtcaagaactggcagaaggatgcctaccacaag
cagatcatgggcggcttcaaggagacgaaggaggcggaggatggcttccgaaaggctcag
aagccctgggctaagaagatgaaggagctggaggcagccaagaaggcctatcacttggct
tgcaaggaggagaagttggccatgacccgggagatgaacagtaagacggagcagtcggtc
acccctgaacagcagaagaaacttgtggataaagtggacaaatgcaggcaggatgtacaa
aagactcaggagaagtatgagaaggtgctggaagatgtgggcaagaccacaccgcagtac
atggagggtatggagcaggtgttcgagcagtgccagcagtttgaggagaagcggctggtc
ttcctgaaggaagtcctgctagatatcaaacggcatctcaacctagcggagaacagcagc
tacattcacgtctatcgagaactggagcaggccatccgaggggccgatgcccaggaggac
ctcaggtggttccgtagcaccagtggccccgggatgcccatgaactggccgcagttcgag
gagtggaacccagacctcccccacaccgctgccaagaaggagaaacagcctaagaaggca
gagggggccgccctgagcaatgccactggggctgtagaatctacatcccaggctggggac
cgtggcagtgtcagcagctatgaccgaggccaagcgtatgccaccgagtggtcagacgat
gagagcggaaacccctttggggggaacgaggccaatggtggcgccaaccccttcgaggac
gatgccaagggagttcgtgtacgggcactctatgactacgacggtcaggagcaggatgag
ctcagcttcaaggccggagacgagctcaccaagctcggagaggaggacgaacagggttgg
tgccgcgggcggctggacagcgggcagctgggcctctatcctgccaactacgttgaggct
atatag

DBGET integrated database retrieval system