KEGG   Rattus norvegicus (rat): 29708Help
Entry
29708             CDS       T01003                                 

Gene name
Gabra6
Definition
(RefSeq) gamma-aminobutyric acid type A receptor alpha 6 subunit
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04723  Retrograde endocannabinoid signaling
rno04727  GABAergic synapse
rno04742  Taste transduction
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29708 (Gabra6)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    29708 (Gabra6)
   04723 Retrograde endocannabinoid signaling
    29708 (Gabra6)
  09157 Sensory system
   04742 Taste transduction
    29708 (Gabra6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    29708 (Gabra6)
   05033 Nicotine addiction
    29708 (Gabra6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29708 (Gabra6)
Ion channels [BR:rno04040]
 Ligand-gated channels
  GABA-A
   29708 (Gabra6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N
Motif
Other DBs
NCBI-GeneID: 29708
NCBI-ProteinID: NP_068613
RGD: 61861
Ensembl: ENSRNOG00000003569
UniProt: P30191
Position
10q21
AA seq 453 aa AA seqDB search
MLLLLPWLFSLLWIENAQAQLEDEGNFYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFKGPAEILSLNNLMVSKIWTPDTFFRN
GKKSIAHNMTTPNKLFRLMHNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQSQKAERQAQTAAKPPVAKSKTTESLEAEI
VVHSDSKYHLKKRISSLTLPIVPSSEASKVLSRTPILPSTPVTPPLLLPAIGGTSKIDQY
SRILFPVAFAGFNLVYWIVYLSKDTMEVSSTVE
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgcttctcccctggctcttcagtttactatggatagaaaatgcccaagctcaa
cttgaagatgaagggaacttctattctgaaaatgtcagtcggattcttgacaacttgctg
gagggctatgacaaccgtctacggccgggatttggaggtgctgtaacagaggtcaaaaca
gatatctatgtgaccagctttgggcctgtgtcagatgtggagatggagtacacaatggat
gttttcttccgacagacatggactgatgagaggctgaagttcaaaggccctgctgagatt
ttgagtttaaataacttgatggtcagtaagatctggactccggacacatttttccgaaat
gggaaaaagtcaattgctcacaacatgaccacccctaacaaactcttccgattgatgcat
aatggaacgatcctgtacaccatgaggcttaccatcaacgctgactgtccgatgagactg
gttaacttccctatggatggacacgcatgtccactcaagtttgggagctatgcctatccg
aaaagcgaaatcatatatacatggaaaaaaggaccgctttattcagtagaggtcccagaa
gaatcttcaagcctcctccagtatgatttgattgggcaaacagtttctagtgagactatt
aaatcgaacacaggtgaatatgtaataatgacagtctacttccacttacaaaggaagatg
ggctatttcatgatccagatttacactccgtgcatcatgacagtcattctctctcaagtg
tctttctggattaataaggagtcggtcccagcaagaaccgtctttggaatcaccacggtt
ttaaccatgaccaccttaagcatcagtgctcggcactctctacccaaagtgtcctatgca
accgccatggattggttcatagctgtatgctttgcgtttgtcttttctgctctcattgaa
ttcgcagctgtcaactacttcaccaatctccagtcccagaaagccgaaaggcaggcacag
actgcagccaagcccccggtagcaaagtcaaaaacaactgaatcactggaagctgagatt
gttgtgcactctgactccaagtaccatctgaagaagagaatcagctctctgactttgcca
atcgttccatcttctgaggccagcaaagtcctcagtagaacgcccatcttaccatcaacg
ccggtcactcccccattgctcttaccagccattggcggcaccagcaaaatagatcaatat
tctcgaattctcttcccagtagcatttgcaggattcaaccttgtgtactggatagtttac
ctttccaaagatacaatggaagtgagcagtactgtcgagtag

DBGET integrated database retrieval system