KEGG   Rattus norvegicus (rat): 297081Help
Entry
297081            CDS       T01003                                 

Gene name
Svs1
Definition
(RefSeq) seminal vesicle secretory protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3 DUF1965
Motif
Other DBs
NCBI-GeneID: 297081
NCBI-ProteinID: NP_954526
RGD: 708424
Ensembl: ENSRNOG00000008714
UniProt: Q6IMK4
Position
4q24
AA seq 917 aa AA seqDB search
MSLVGRILTLGWMTAILVVQMSVAEHSRWALNTRPRVLWDLSAEELECVHNFLMSRKELE
LQPSTVLTLAKNSVFLIEMLMPKKYEVLDFLDKGAMPPLREARVLIYFGAQEYPNVTEYA
VGPVDQPMYMRKLNRKGGQELSWVSRPMSKVESALLFHTLKTATKPLQEFFFDTTGFTLQ
DCNGGCLTFTNVGPRDMTFRNRHSWFLLQRFMNGHFLQPTGLEILVDHGSTDVQDWRVVQ
IWYNGKFYSSPEELAQKYADGEVDIVVLEDPLPKTSEQFPQFSTYKPHAEFLMPISKGGP
RVVQPYPEFPMPIRKGGPRVAQPYPEFSMPISKGGPRVPQPYSEFSTPIRKGGPRVPQPY
SEFPTPIRKGGPQVAQPYPEFSIPISKGGPRVPQPYSEFPTPIRKGGPRVPQPYSEFPTP
IRKGGPRVPQPYSEFPTPIRKGGPQVTHPYSEFPTPISKGGPQVAQPYPKFPRPISKGGP
QVAQLYPKFPTPIRKGGPQVAQSSVPRYRLKHNTVLYGDWSFFFKLQSSYGLQLFNVHFR
GERIAYEVGVQEVMALYKGHKAGGRETKYVDVGWGLGGITHQLTPGIDCPHKATFLDAIH
YYDSDGPVLSRQALCIFEVPVGVPLRHYFNSNFRSSFSSYARLGGPMLVLRTASTIHNHD
YIWDFIFHSNGIMEGKMYATGYVHATFYTSEGMLYHSRLHTHLLGNVHSHLAHYRIDLDV
AGTKNSFQTLKMRLENITDPWSQRSQQVKPIFDKTQYSQERQAAFHFRQTLPKYLLFSNT
GKSVLGRSHSYLLHVPSMAEQMLPPGWQNSPAFLWPRYQLAVTKYQESERFHSSLYNQNH
HWAYPMVFENFIHNNENIEDEDLVAWVTVGLSNNLHSEIAPSTATLGNAAGFLLQPFDLY
NNFQRYTASPTRAQCVC
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggtaggaaggatcttgactctgggctggatgactgccatcttggtggtgcag
atgtctgtggcagagcactccaggtgggcactgaataccaggccccgggtgttgtgggac
ttgagtgctgaggagctggagtgcgtgcacaacttcctgatgagcaggaaggagctggaa
ctgcagccatccacggtactgactttggccaagaactctgtgttcctcattgagatgctg
atgcccaagaagtatgaggtgctggatttcctagataaaggagccatgcctcctttacgg
gaagcccgtgtcctgatctattttggtgcccaggagtaccccaatgtcaccgagtatgct
gtggggcccgttgatcaacccatgtacatgcgaaaactgaaccgcaagggtggccaggag
ctgtcatgggtatctaggcccatgtccaaagtagagtctgcccttctcttccatactctg
aagacagccaccaagcccttacaagagtttttctttgataccactggcttcacactgcag
gactgcaacggcggctgcctgacctttaccaatgttggacctcgcgatatgacattcaga
aaccgccatagctggtttcttttgcaacgctttatgaatggccacttcctgcagcccacg
gggctggagatcctcgtggatcatgggagcacagatgtccaggactggagagtagtgcag
atctggtataatggcaagttctacagcagccctgaggaactggctcagaaatacgcagat
ggagaagtggacatagtggtcctcgaggacccactgcccaagacttcagaacagtttcca
cagttctccacctacaagccccatgctgaattcctcatgcctatcagcaagggtggccct
cgagtggtccagccctatcctgaattccctatgcccatcaggaagggtggtcctcgagtg
gcccagccttatcctgaattctccatgcccatcagcaagggtggccctcgagtaccccag
ccctattctgaattctctacacccatcaggaagggtggccctcgagtaccccagccctat
tctgaattccctacacccatcaggaagggtggtcctcaagtggcccagccctatcctgaa
ttctccatacccatcagcaagggtggccctcgagtaccccagccctattctgaattccct
acacccatcaggaagggtggccctcgagtaccccagccctattctgaattccccacaccc
atcaggaagggtggccctcgagtaccccagccctattctgaattccctacacccatcagg
aagggtggtcctcaagtgacccatccctattctgaattccccactcccatcagcaagggt
ggccctcaagtggcccagccctatcctaaatttcccaggcccatcagcaagggtggccct
caagtggcccagctctatcctaaattccccacgcccatcaggaagggtgggcctcaagtg
gcccagtccagtgttccccgctacaggctaaaacataacactgtgctctacggagactgg
agcttcttcttcaagctgcagtcttcctatgggcttcagctctttaatgtacacttcaga
ggcgaacgtatcgcctatgaggttggtgtgcaagaggttatggcactgtataaaggacac
aaagctggaggcagggagaccaagtacgtggatgtgggctggggcctaggaggtatcact
caccagctaactcctggcattgattgtccccacaaagccaccttcctggatgccatccac
tactatgacagcgacggtcctgtcctctctcggcaagccctctgtatctttgaagtgccc
gtgggggttccccttaggcactactttaactccaactttagaagtagcttcagttcctac
gccaggctgggtggacccatgctggttctgaggacagcatcgacgatccacaatcacgat
tacatctgggacttcatcttccactccaatggcataatggagggcaagatgtatgctacc
gggtatgttcatgccactttctacacctcagaagggatgctctaccacagtcgcctgcac
acccacctactcggcaacgtccactcccacctcgcgcattatcgcattgacctggatgtg
gcaggtacaaagaacagcttccagaccctgaagatgagattggaaaacatcaccgacccc
tggagccagagaagccagcaggtcaagcccatcttcgacaagacccagtactcccaggag
cgccaggctgccttccacttcaggcagactctgcccaagtacctgctttttagcaacact
ggaaaaagtgtgttgggtcgcagccacagctacctcctgcatgtcccctccatggctgag
caaatgctgcccccgggctggcagaactcaccagctttcttgtggcccaggtaccagctg
gcagtgactaagtaccaggagtctgaacggttccacagtagcctttacaaccagaaccat
cactgggcttaccctatggtctttgagaacttcattcacaacaatgaaaacatcgaagat
gaggacttggtggcctgggtgacagtcggcctctcaaacaacctccattctgagattgcc
cccagcacggctacgctggggaacgctgcaggattcttgctccagccatttgatttgtac
aacaacttccagagatatacagcctctccgactcgtgcccagtgtgtgtgctga

DBGET integrated database retrieval system