KEGG   Rattus norvegicus (rat): 297093Help
Entry
297093            CDS       T01003                                 

Gene name
Cbx3, Hp1-gamma
Definition
(RefSeq) chromobox 3
  KO
K11586  chromobox protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    297093 (Cbx3)
   03036 Chromosome and associated proteins [BR:rno03036]
    297093 (Cbx3)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    297093 (Cbx3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Heterochromatin formation proteins
   HP1 (heterochromatin protein 1)
    297093 (Cbx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chromo_shadow Chromo Mtf2_C DTHCT
Motif
Other DBs
NCBI-GeneID: 297093
NCBI-ProteinID: NP_001008314
RGD: 1549705
Ensembl: ENSRNOG00000011814
UniProt: Q5RJK5
Position
4q24
AA seq 183 aa AA seqDB search
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNT
WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARG
LDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPED
EAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaataaaactacattgcaaaaaatgggaaagaaacagaatggaaagagtaaa
aaagttgaagaggcagagcctgaagaatttgtggtagaaaaagtactggaccgtcgtgta
gtgaatgggaaggtggagtatttcctgaagtggaaggggttcacagatgctgataatact
tgggaaccagaagaaaatttagattgtccagaattaattgaagcatttcttaattctcaa
aaagctggtaaagaaaaagatggtacaaaaaggaaatctttatctgacagtgaatctgat
gatagcaaatcgaagaagaagagagatgctgctgacaagcccaggggctttgccaggggc
cttgaccctgagcgaataatcggtgccacagacagcagtggagagctaatgtttctcatg
aaatggaaggactcagatgaagctgacttggtgctggcaaaggaggcgaatatgaagtgt
cctcagattgtcatcgccttctatgaggagaggctgacttggcattcttgtcccgaagat
gaagcacaataa

DBGET integrated database retrieval system