KEGG   Rattus norvegicus (rat): 297113
Entry
297113            CDS       T01003                                 

Gene name
Gars, GlyRS, RGD1559871
Definition
(RefSeq) glycyl-tRNA synthetase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    297113 (Gars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    297113 (Gars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    297113 (Gars)
   03029 Mitochondrial biogenesis [BR:rno03029]
    297113 (Gars)
Enzymes [BR:rno01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     297113 (Gars)
Amino acid related enzymes [BR:rno01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   297113 (Gars)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    297113 (Gars)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    297113 (Gars)
SSDB
Motif
Pfam: HGTP_anticodon tRNA-synt_2b WHEP-TRS OS-D
Other DBs
NCBI-GeneID: 297113
NCBI-ProteinID: NP_001258068
RGD: 1307856
Ensembl: ENSRNOG00000011052
UniProt: Q5I0G4
Position
4q24
AA seq 728 aa
MPCLLPTLLRATRAALLLQSPRVVAAPASQRLLSAPAQPAASPSSMDSAEELLAPLRLAV
RQQGDFVRKLKEDKAPQVDVDRAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRR
FFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKT
SGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSAEKKSEMESVLAQLDNYGQ
QELADLFVNYNVKSPTTGNDLSPPVPFNLMFQTFIGPGGNMPGYLRPETAQGIFLNFKRL
LEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPTEKDHPKFPSVADL
YLYLYSAKAQVTGQSARKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPDKLRFRQ
HMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKT
VNVVQFEPNKGAVGKAYKKDAKLVLEYLGACDECYITEMELLLSEKGEFTIETEGKTFQL
TKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTILEHTFHVREGDEQRTFFSFPAVV
APFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGIT
IDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRDLANGNITWADVEARYPLFEGQET
GKKETVEE
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgccctgtctgctccccacgctgctcagagccacccgcgccgcgctgctcctacagtcg
ccccgagtggtcgcagcgcccgcgtctcagcggctcctcagcgctcccgcgcagcccgcc
gcctctccgagcagcatggacagcgccgaggagctgctagccccattgcggctagctgtg
cgccagcagggagactttgtacggaagttaaaagaagataaagccccacaagtggatgtg
gacagagcagtagctgagctcaaggcccggaagagggttctggaagcaaaggagctggcg
ttgcagcccaaagatgacatcgtagatagagcaaaaatggaggatactttgaagaggaga
tttttctacgatcaagcttttgctatttatggaggtgtcagtggtttgtatgactttggg
ccagtgggatgtgctttgaagaacaatatcatccagacctggaggcagcactttatccaa
gaggaacagatcctggaaattgactgcaccatgctcacccccgagccagttttaaagacc
tctggccatgtagacaaatttgctgacttcatggtgaaggacgtgaagaacggagagtgc
ttccgcgcggaccacctgttgaaagctcatttacagaaactgatgtcagataagaagtgc
tctgctgagaagaaatcagagatggaaagtgtcttggcccagcttgataactatggacaa
caagaactggcggatctttttgtgaactataatgtaaaatctcccaccactggcaatgac
ctgtcccctccggtaccttttaacttaatgttccagaccttcattgggcctggaggaaac
atgcctggatatctgagaccagaaactgcacagggaattttcctaaatttcaaacgactt
ttggaattcaaccaagggaagttgccttttgctgctgcacagattggaaactcctttaga
aatgagatctcgccccggtctggactgatccgagtcagggaattcacaatggcagagatc
gagcactttgtagatcccactgagaaagaccatcccaagttcccgagcgtggccgacctc
tacctttatttgtactctgccaaagcccaggtcactggacagtctgctcgcaagatgcgt
ctgggagatgctgttgaacagggtgtgattaacaactcagtattaggctattttattggc
cgcatctacctctacctcacgaaggttggaatatctcctgataaactccgcttccgacag
catatggagaatgagatggcccattatgcctgcgactgctgggatgctgagtccaaaacg
tcctatggctggatcgagattgttggatgtgctgaccgatcctgctatgacctctcctgt
catgctcgagccaccaaagtcccgctggtggctgagaagcccctgaaagagcccaaaaca
gttaacgttgtacagtttgagcccaacaagggagccgtgggcaaggcgtacaagaaagat
gcaaagctggtgctggagtacctcggcgcctgcgatgagtgctacattaccgagatggag
ctgctgctgagcgagaaaggggaattcactattgaaactgaaggaaaaacatttcagtta
acaaaagacatggtcagtgtgaagagattccagaaaacactacacgtggaagaagttgtt
ccgagtgtaattgagccctcttttggcctgggcaggatcatgtataccatattggaacat
acattccacgtccgggagggagatgagcagagaacgttcttcagtttccctgctgtggtt
gctccattcaaatgttctgtccttccactgagccaaaaccaagagtttatgccatttgtc
aaggaattatcggaagctctgactcgaaatggcgtgtctcataaagttgacgattcctct
gggtctattggaaggcgctatgcaagaactgatgagattggcgtggcgtttggcatcacc
attgactttgatacagtgaacaagaccccccacactgcaactctgagggaccgagactcc
atgagacagataagggcagaggtctctgaactgcccagtgtggtccgtgatctggccaat
ggcaacatcacttgggctgatgtggaggccaggtaccccctctttgaagggcaagagact
ggcaagaaggagacagtggaagaatga

DBGET integrated database retrieval system