KEGG   Rattus norvegicus (rat): 29715Help
Entry
29715             CDS       T01003                                 

Gene name
Slc8a1, Ncx, Ncx1
Definition
(RefSeq) solute carrier family 8 member A1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04371  Apelin signaling pathway
rno04740  Olfactory transduction
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04974  Protein digestion and absorption
rno04978  Mineral absorption
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    29715 (Slc8a1)
   04020 Calcium signaling pathway
    29715 (Slc8a1)
   04022 cGMP-PKG signaling pathway
    29715 (Slc8a1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29715 (Slc8a1)
   04261 Adrenergic signaling in cardiomyocytes
    29715 (Slc8a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    29715 (Slc8a1)
   04978 Mineral absorption
    29715 (Slc8a1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    29715 (Slc8a1)
  09157 Sensory system
   04740 Olfactory transduction
    29715 (Slc8a1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    29715 (Slc8a1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    29715 (Slc8a1)
   05414 Dilated cardiomyopathy (DCM)
    29715 (Slc8a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29715 (Slc8a1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29715 (Slc8a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   29715 (Slc8a1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Others
   29715 (Slc8a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_Ca_ex Calx-beta Na_Ca_ex_C DnaG_DnaB_bind
Motif
Other DBs
NCBI-GeneID: 29715
NCBI-ProteinID: NP_001257705
RGD: 3717
Ensembl: ENSRNOG00000008479
UniProt: Q01728
Position
6q12
AA seq 969 aa AA seqDB search
MLRLSLPPNVSMGFRLVTLVALLFTHVDHITADTEAETGGNETTECTGSYYCKKGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETT
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIII
ALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVSSPGVVEVWEGLLTFFFFP
ICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPASKTEIEMDGKVVNSHVDNF
LDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNMDVVENDPVSKVFFEQGTYQCLENCG
TVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVIFKPGETQKEIRVGIIDDD
IFEEDENFLVHLSNVRVSSEVSEDGILDSNHVSAIACLGSPNTATITIFDDDHAGIFTFE
EPVTHVSESIGIMEVKVLRTSGARGNVIIPYKTIEGTARGGGEDFEDTCGELEFQNDEIV
KIITIRIFDREEYEKECSFSLVLEEPKWIRRGMKALLLNELGGFTLTGKKMYGQPVFRKV
HARDHPIPSTVISISEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKS
TVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTVF
WKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVALG
TSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSP
GTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSSLFVLLWLLYIFFSSL
EAYCHIKGF
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgactaagtctcccacccaatgtttcaatgggatttcgtctggtaactctggtg
gctctcttgtttacccatgttgaccatataactgcagatacagaggcagaaacaggagga
aatgaaaccactgaatgtactggctcatattactgtaagaaaggggtgattctgcccatt
tgggaaccccaagacccatcttttggggataaaattgctagagcaactgtgtattttgtg
gccatggtctacatgttcctcggagtttctattattgccgaccggtttatgtcctctata
gaagtcatcacctctcaagaaaaggagattaccataaagaaaccaaatggagagaccacc
aagactacagtgcgtatctggaatgagactgtgtccaacctgaccttgatggccctggga
tcttccgctcctgagattctcctgtctgtcattgaagtgtgtggccataacttcaccgca
ggggaccttggtcccagcaccattgtgggaagcgccgccttcaacatgttcatcatcatc
gcgctttgtgtttatgtggtcccagatggagagacgaggaagattaaacatctgcgtgtg
ttctttgtgacagcagcctggagcatctttgcctatacctggctttacataattttgtct
gtcagctctcctggtgtcgtggaggtctgggaaggattactcactttcttcttctttccc
atctgtgttgtgttcgcttgggttgcagacaggcggcttctcttttacaagtatgtctac
aagcggtacagggctggcaagcagagggggatgatcattgaacatgaaggagacagacca
gcttccaaaactgaaattgaaatggatgggaaagtagtcaactcccacgttgacaatttc
ttagatggcgctctggttttggaagtcgatgagagggaccaagatgacgaggaagccagg
cgtgagatggcaaggattctgaaggaacttaagcagaagcatcccgacaaagagatcgaa
caattaatagaattagccaactatcaagtcctaagtcagcagcaaaagagccgagcattt
taccgaattcaagctactcgcctgatgactggagctggtaacattttgaagaggcatgca
gctgaccaagcgaggaaggctgtcagcatgcatgaagtcaacatggatgtggttgaaaat
gacccagtcagtaaggtcttctttgagcaagggacataccagtgtctagaaaactgtggt
actgtggccctcaccattattcgaagagggggtgacttgaccaacactgtgtttgttgac
ttcaggacggaagatggcacagccaatgctgggtctgattatgagttcacggaagggact
gtgatcttcaaacctggggagacccagaaggaaatcagagttggcatcattgatgatgat
atctttgaagaagatgaaaactttcttgtgcatcttagcaacgtcagggtctcttcagaa
gtctcggaagatggcatactagactccaatcacgtgtctgcgattgcttgtctcgggtca
cccaacactgccaccataaccatttttgatgatgaccacgcgggcatctttactttcgag
gaacccgtgactcacgtgagcgagagcattggcatcatggaggtgaaggtgctgagaacc
tctggagcgcgaggaaatgttatcattccctataaaaccattgaaggcacagcccgaggt
ggaggggaggactttgaggacacctgtggagagctggaattccagaatgatgaaatagtg
aagatcattaccattagaatatttgaccgtgaggaatatgagaaagagtgcagtttctcc
cttgtgcttgaggaaccaaaatggataagaagaggaatgaaagccctgttgttaaatgag
cttggtggcttcacattaacaggaaaaaagatgtatggccaacctgtcttcaggaaggtc
catgctagagatcatccgattccctctaccgtaatcagcatttcagaggagtacgatgac
aagcagccactgaccagcaaagaggaggaggagaggcgcattgcagaaatggggcgcccc
attctaggcgaacacaccaagctggaagtgatcattgaagagtcttacgaattcaagagc
actgtggacaaactcattaagaagacgaacctggccctcgtggtggggaccaacagctgg
agagagcagttcattgaagcgatcaccgtcagcgctggggaagatgacgatgatgatgaa
tgtggggaggagaagctgccctcctgttttgattacgtgatgcactttctcacagtgttc
tggaaggttctgtttgccttcgtcccacctacagaatattggaatggctgggcctgcttc
attgtctccatcctcatgatcggcctactgacagccttcattggagatctggcttcccac
tttggctgcaccattggtctgaaagattccgtgactgcagttgtgtttgtcgctcttgga
acctcagtgccagacacatttgccagcaaagtagcagctacccaggaccagtatgcagat
gcgtccataggcaatgtcaccggaagcaacgctgtgaatgtcttcctgggaatcggcgtg
gcctggtccattgctgccatctaccatgcggccaacggggaacagttcaaagtgtcccct
ggcacgctagctttctctgtcactctcttcaccatttttgctttcatcaacgtgggggtg
ctgctgtatcggcggaggccagaaataggaggtgagctgggtgggccccggactgccaag
ctcctcacatcttccctgtttgtgctcctgtggctcttgtacattttcttctcctccctg
gaggcctactgccacataaaaggcttctaa

DBGET integrated database retrieval system