KEGG   Rattus norvegicus (rat): 297176
Entry
297176            CDS       T01003                                 

Gene name
Mad2l1
Definition
(RefSeq) MAD2 mitotic arrest deficient-like 1 (yeast)
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    297176 (Mad2l1)
   04114 Oocyte meiosis
    297176 (Mad2l1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    297176 (Mad2l1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    297176 (Mad2l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    297176 (Mad2l1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     297176 (Mad2l1)
SSDB
Motif
Pfam: HORMA ATG101 bacHORMA_2
Other DBs
NCBI-GeneID: 297176
NCBI-ProteinID: NP_001100064
RGD: 1310889
Ensembl: ENSRNOG00000005376
UniProt: D4ACM2
Position
4q31
AA seq 205 aa
MAQQLARDQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDPE
LIKYLNNVVEQLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKEEGVRREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE
VRLRSFTTTIHKVNSMVAYKTPVSD
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcacagcagctcgcccgggaccaaggcatcaccctgcgtgggagcgcagaaatcgtc
gccgagtttttttcatttggcatcaacagcattttgtatcagcgtggcatttatccgtcg
gaaacctttactcgagtgcagaaatatggactcaccttgcttgtaactactgaccccgag
ctcataaagtatctcaataatgtggtagagcagctaaaagagtggttgtacaagtgctcc
gttcagaaactggtagtggtcatctcgaatattgaaagtggcgaggtccttgaaagatgg
cagtttgatattgagtgtgacaaaacggccaaagaagaaggtgttcgtagagaaaagtcc
cagaaagccatacaggatgaaatccgttcagtgatcagacagatcacagccactgtgaca
tttctaccactgttggaggtttcttgttcatttgatctgctgatttatactgacaaagat
ttggtggtacctgaaaagtgggaagaatcgggaccccagtttattaccaattctgaagaa
gtccgtctacgctcattcactaccacaatccacaaagtgaacagtatggtggcctacaaa
acacctgtcagtgactga

DBGET integrated database retrieval system