KEGG   Rattus norvegicus (rat): 297176
Entry
297176            CDS       T01003                                 

Gene name
Mad2l1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2A
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    297176 (Mad2l1)
   04114 Oocyte meiosis
    297176 (Mad2l1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    297176 (Mad2l1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    297176 (Mad2l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    297176 (Mad2l1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     297176 (Mad2l1)
SSDB
Motif
Pfam: HORMA ATG101 bacHORMA_2
Other DBs
NCBI-GeneID: 297176
NCBI-ProteinID: NP_001100064
RGD: 1310889
Ensembl: ENSRNOG00000005376
UniProt: D4ACM2
Position
4
AA seq 205 aa
MAQQLARDQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDPE
LIKYLNNVVEQLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKEEGVRREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE
VRLRSFTTTIHKVNSMVAYKTPVSD
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcacagcagctcgcccgggaccaaggcatcaccctgcgtgggagcgcagaaatcgtc
gccgagtttttttcatttggcatcaacagcattttgtatcagcgtggcatttatccgtcg
gaaacctttactcgagtgcagaaatatggactcaccttgcttgtaactactgaccccgag
ctcataaagtatctcaataatgtggtagagcagctaaaagagtggttgtacaagtgctcc
gttcagaaactggtagtggtcatctcgaatattgaaagtggcgaggtccttgaaagatgg
cagtttgatattgagtgtgacaaaacggccaaagaagaaggtgttcgtagagaaaagtcc
cagaaagccatacaggatgaaatccgttcagtgatcagacagatcacagccactgtgaca
tttctaccactgttggaggtttcttgttcatttgatctgctgatttatactgacaaagat
ttggtggtacctgaaaagtgggaagaatcgggaccccagtttattaccaattctgaagaa
gtccgtctacgctcattcactaccacaatccacaaagtgaacagtatggtggcctacaaa
acacctgtcagtgactga

KEGG   Rattus norvegicus (rat): 313702
Entry
313702            CDS       T01003                                 

Gene name
Mad2l2
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2B
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    313702 (Mad2l2)
   04114 Oocyte meiosis
    313702 (Mad2l2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    313702 (Mad2l2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    313702 (Mad2l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    313702 (Mad2l2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     313702 (Mad2l2)
SSDB
Motif
Pfam: HORMA
Other DBs
NCBI-GeneID: 313702
NCBI-ProteinID: NP_001012106
RGD: 1307499
Ensembl: ENSRNOG00000009134
Vega: OTTRNOG00000000755
UniProt: D3Z8D9
Position
5
AA seq 234 aa
MTTLTRQDLNFGQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSIKLGGLKQTVS
LTVLGSWRYADLSGTLGVLSTAEYLSDLKGPLYPTSIQSVQTPSCLMWSSCFEPSFLRLV
CVTLSSTIILQAARLQFSCTQEKLPLGTWRRYRSSRTSPGSWQMSKMSTCMIPG
NT seq 705 nt   +upstreamnt  +downstreamnt
atgaccaccctcacgcgccaagacctcaacttcggccaagtggtggccgacgtgctctcc
gagttcctggaggtggccgtgcacttgatcctctatgtgcgcgaggtctacccggtgggc
atctttcagaagcgcaagaagtacaacgtgccggttcagatgtcctgccacccagagctg
aaccagtacatccaggacacacttcactgcgtcaaaccactcctggagaagaacgatgtg
gagaaggtggtggtggtgattttggataaggaacaccgcccagtggagaagtttgtcttt
gagatcactcagccacccttgctgtccatcaagctaggtggcctcaaacagaccgtttct
ctaactgtcttggggtcctggaggtatgcagacttgagcggtaccctgggtgtcctctcg
acagctgaatatttgagtgacctaaagggacctttgtaccctacctctattcagtcagtt
cagactccctcctgtctcatgtggagcagctgcttcgagccttcattcttaagattagtg
tgtgtgacgctgtcctcgaccataatcctccaggctgcacgtttacagttctcgtgcaca
caagagaagctgccactcggaacatggagaagatacaggtcatcaaggacttcccctgga
tcctggcagatgagcaagatgtccacatgcatgatccccggttga

KEGG   Rattus norvegicus (rat): 680006
Entry
680006            CDS       T01003                                 

Gene name
Mad1l1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    680006 (Mad1l1)
   04114 Oocyte meiosis
    680006 (Mad1l1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    680006 (Mad1l1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    680006 (Mad1l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    680006 (Mad1l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680006 (Mad1l1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     680006 (Mad1l1)
SSDB
Motif
Pfam: MAD TSC22 DUF2856
Other DBs
NCBI-GeneID: 680006
NCBI-ProteinID: NP_001102857
RGD: 1596881
Ensembl: ENSRNOG00000001265
UniProt: D3ZIV3
Position
12
AA seq 717 aa
MEDLGENTTVLSTLRSLNNFISQRMEGASGLDVSTSASGSLQKQYEQNMQLEERAEQIRS
KSYLIQVEREKMQMELSHKRARVELERAASTNARNYEREVDRNQELLARIRQLQEREAAA
EEKMREQLERHRLCKQSLDAASQQLREREDGLAAARETISSLKGRVSELQLSAMDQKVQV
KRLESEKQELKEQLELQQRKWQEANQKIQELQASQEERTDQEQKIKDLEQKLCLQEQDAA
VVKSMKSELLRLPRMERELKRLREENTHLREMRETNGLLTEELEGLQRKLGRQEKMQEAL
VDLELEKEKLLAKLQSWEKLDQTMGLNLRTPEDLSRFVIELQQRELALKEKNSSITSSAR
GLEKAQQQLQDEVRQVNAQLLEERKKRETHEALARRLQKRNALLTKERDGMRAILGSYDS
ELTQAEYSPQLTQRMWEAEDMVQKVHAHSSEMEAQLSQALEELGVQKQRADTLEMELKML
RAQTSSAEASFPFCKEEVDALRLKVEELEGERSRLEQEKQALEMQMERLTLQGDYNQSRT
KVLHMSLNPASMARQRQREDHDRLQEECERLRGLVHALERGGPIPADLEAASSLPSSKEV
AELRKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQIDVTTESQYRLTSRYAEHQTD
CLIFKATGPSGSKMQLLETEFSRSVPELIELHLLQQDSIPAFLSALTIELFSRQTSV
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggaagaccttggggagaacaccacagtcctgtccaccctgagatctctcaacaacttc
atttctcagcgaatggagggagcatcaggcttggatgtgtccacatctgcctcagggtcc
ctacagaagcagtatgaacagaacatgcagctggaggagagagcagagcagatccgttca
aagtcctacctcatccaggtggagcgggagaagatgcagatggagctgagccacaagagg
gctcgggtggagctggagagagcggccagcaccaatgccaggaactatgagcgcgaggtg
gatcgcaaccaggaactcctggcacgcattcggcagctccaggagcgtgaggccgcagca
gaagagaagatgcgggagcagctggagcgccacaggctgtgcaagcagagcctggacgct
gccagtcagcagctgcgggaacgagaggatggcctggctgcagccagggagacgattagt
tcattgaaggggcgagtctccgagctgcagttgagtgcgatggaccagaaggtacaggtc
aagcgcctggagtctgagaagcaggagctgaaggagcagctggaactgcagcagcggaaa
tggcaggaggcaaatcagaagatccaggagctacaggccagtcaagaagagagaactgac
caggagcagaagattaaggacctggagcagaagctgtgtctgcaagagcaggatgcagct
gtggtgaagagcatgaaatctgagctgttgcgactgcctcggatggagcgtgagctaaag
aggctgcgtgaggagaacactcatctaagggagatgagggagaccaatgggctgctcaca
gaggagctggaaggtctgcagaggaagctgggccgccaggagaagatgcaggaagctctg
gttgatctggagttggagaaggagaagctgcttgcaaagctgcagagctgggagaaactg
gaccagaccatgggcttgaatctcaggactccagaggacctttcgaggttcgtgattgag
ctgcagcagcgagagctggcgctgaaggagaagaatagcagcatcaccagcagtgcccgg
ggtctggagaaggcccagcagcagctccaggatgaggtccggcaggtcaatgcacagctg
ctggaagagaggaagaagagggagacacatgaggcacttgcccgaaggctccagaagcgc
aatgcattgctgaccaaggagcgagacggcatgcgcgccatcctgggatcctacgacagt
gagctgacccaagctgagtactcgccccagcttacacagcgcatgtgggaggctgaggac
atggttcagaaggtgcatgcccacagctcagagatggaggctcagctgtctcaggccctg
gaagagcttggggttcagaagcagagagctgacacgctggagatggagttgaagatgctg
agggcccagacaagctcagccgaagccagcttcccattctgcaaagaggaggtggatgca
ctcaggttgaaggtggaggagctggagggtgagcggagccgtctggaacaggaaaagcag
gctctggagatgcagatggagagactaaccctacagggtgactacaaccagagtcgaacc
aaagtgctacacatgagcctgaacccggctagcatggccaggcagcgccagcgtgaggac
catgaccggctgcaggaggaatgcgagcgcttacggggacttgtgcatgccctagagaga
ggcggtcccatccctgctgacctggaggctgcctccagcctgccctcatccaaggaggtg
gcagagctgcggaagcaggtagaaagcgctgagctgaagaaccagcggctcaaggaggtt
ttccagaccaagatccaggagttccgcaaggtttgctacacactgaccggctaccagatt
gacgtgaccactgagagccaataccgcctcacctcccgatatgctgagcaccagactgac
tgcctcatcttcaaggccacaggaccctcgggctccaaaatgcagctgctggagacggag
ttctcccgttcagtgcctgagctcattgagctgcacctgctgcagcaggacagcatccct
gccttcctcagcgcgctcaccatagagctgttcagccgccagacctctgtctag

DBGET integrated database retrieval system