KEGG   Rattus norvegicus (rat): 29718
Entry
29718             CDS       T01003                                 

Gene name
Kcnj10
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 10
  KO
K05003  potassium inwardly-rectifying channel subfamily J member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04971  Gastric acid secretion
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    29718 (Kcnj10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    29718 (Kcnj10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29718 (Kcnj10)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   29718 (Kcnj10)
SSDB
Motif
Pfam: IRK_C IRK DUF2182 Ion_trans_2
Other DBs
NCBI-GeneID: 29718
NCBI-ProteinID: NP_113790
RGD: 61822
UniProt: P49655
Position
13
AA seq 379 aa
MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEES
LREQAEKEGSALSVRISNV
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgacatcagttgccaaggtctattacagccagacgacgcagacagagagccggccccta
gtggctccaggaatacgtcggaggagggtcctgacaaaagatggccggagcaacgtgaga
atggagcatattgctgacaagcgtttcctctacctcaaggatctatggacgaccttcatt
gacatgcagtggcgctacaagcttctgctcttctcggcaacctttgcaggcacttggttc
ctctttggcgtggtgtggtatctggtcgctgtggcccacggggacctgttggagctggga
cctcctgccaaccacacgccctgtgtggtgcaggtgcacacacttactggggccttcctc
ttctccctcgaatcccagaccaccattggctatggcttccgctacatcagcgaggaatgc
cctctggccattgtgcttctcattgcacagctcgtgctcaccaccattctggaaatcttc
atcaccggaaccttccttgcaaagattgcccggccaaagaagagggctgagacgatccgt
ttcagccagcatgcggttgtggcttaccacaacgggaagctttgcctcatgatccgggtg
gccaacatgcgtaagagtctcctcattgggtgccaggtgacaggcaaactgcttcaaacc
caccagacaaaggagggtgagaatattcggctcaaccaggtcaatgtgactttccaagta
gacacagcctctgatagcccctttctcattctacccctgactttctaccatgtggtagat
gagaccagccccttgaaagatctccccctccgcagcggggagggtgacttcgagctcgtg
ctgatcctaagtgggacggtggagtccaccagcgccacctgtcaagttcgcacttcctat
ctaccggaggagatcctctggggctacgagttcacacctgctatctcactgtcagccagt
ggcaaatacgtggctgacttcagcctttttgaccaggttgtgaaagtggcgtcccccggt
ggtctccgagatagcaccgtacgttatggagacccagaaaagctcaagttggaggagtca
ttaagagagcaagctgaaaaggaaggcagtgcccttagtgtgcgcattagtaacgtctga

DBGET integrated database retrieval system